BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000706-TA|BGIBMGA000706-PA|undefined (99 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 0.59 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 0.59 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 23.0 bits (47), Expect = 0.59 Identities = 11/39 (28%), Positives = 21/39 (53%) Query: 1 MEQKATKTDFLLQIPLILEGVGRSNDMKCMMPYEELVNV 39 ++Q A T FL + ++ RSND+K ++ E + + Sbjct: 109 IDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNLESIQI 147 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 23.0 bits (47), Expect = 0.59 Identities = 11/39 (28%), Positives = 21/39 (53%) Query: 1 MEQKATKTDFLLQIPLILEGVGRSNDMKCMMPYEELVNV 39 ++Q A T FL + ++ RSND+K ++ E + + Sbjct: 65 IDQMAGYTGFLAMLTSMVMFYKRSNDLKTLLSNLESIQI 103 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,225 Number of Sequences: 317 Number of extensions: 616 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 114,650 effective HSP length: 48 effective length of query: 51 effective length of database: 99,434 effective search space: 5071134 effective search space used: 5071134 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.3 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -