BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000706-TA|BGIBMGA000706-PA|undefined (99 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016447-8|AAG24010.1| 189|Caenorhabditis elegans Hypothetical ... 26 3.9 U41263-3|AAC24425.1| 361|Caenorhabditis elegans Hypothetical pr... 25 6.8 >AF016447-8|AAG24010.1| 189|Caenorhabditis elegans Hypothetical protein C54F6.5 protein. Length = 189 Score = 26.2 bits (55), Expect = 3.9 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query: 23 RSNDMKCMMPYEELVNVRDMLKSVSNCVSGGLARIIAALTDLHFTTFLAGAN 74 + ND++C++ E + V D K C SG + + + D T G N Sbjct: 26 KENDIECVLSCE-VDKVEDWEKCAEGCYSGKMGKFYFIIYDSDRTFVSCGTN 76 >U41263-3|AAC24425.1| 361|Caenorhabditis elegans Hypothetical protein T19D12.5 protein. Length = 361 Score = 25.4 bits (53), Expect = 6.8 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Query: 14 IPLILEGVGRSNDMKCMMPYEELVNVRDMLKS-----VSNCVSGGLA-RIIAALTDLHFT 67 +P+I G G + ++ +NV D+ KS +S C G + ++IAAL DLH T Sbjct: 121 VPMIY-GSGHAEKYNFIIMQILSINVGDIKKSSPNKKLSQCSVGRIIHQVIAALQDLHET 179 Query: 68 TFL 70 ++ Sbjct: 180 GYV 182 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,245,581 Number of Sequences: 27539 Number of extensions: 71533 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 165 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 12,573,161 effective HSP length: 70 effective length of query: 29 effective length of database: 10,645,431 effective search space: 308717499 effective search space used: 308717499 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -