BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000705-TA|BGIBMGA000705-PA|IPR003929|Calcium-activated BK potassium channel, alpha subunit (1061 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0250 - 26682207-26683811 33 1.2 05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263,245... 31 3.7 >05_06_0250 - 26682207-26683811 Length = 534 Score = 33.1 bits (72), Expect = 1.2 Identities = 21/97 (21%), Positives = 37/97 (38%), Gaps = 4/97 (4%) Query: 165 TILRSWAVKDFAPKVAQYVQIFRPENKLHVKFAEFVVCEDEFKYALLA---NNCTCPGAS 221 T + +W VKD RP ++LH+ F +C D L + NCT P Sbjct: 181 TAIDAWGVKDLEILAGTPAHQLRPLDRLHI-FPHQGICSDPRSSTLTSLTLANCTIPPLQ 239 Query: 222 TLVTLLLHTSRGQEGQQSPEEWHRLYGKCSGNEIYHI 258 L + + P ++ ++ C+ + H+ Sbjct: 240 GFQALRILVLQHLPSSTRPADYESVFTSCTQLRVLHL 276 >05_01_0311 + 2452230-2452232,2452401-2452809,2454136-2454263, 2455287-2455436,2455526-2455681,2455775-2455986, 2456306-2456407,2456517-2456653,2456769-2457055 Length = 527 Score = 31.5 bits (68), Expect = 3.7 Identities = 29/137 (21%), Positives = 51/137 (37%), Gaps = 2/137 (1%) Query: 335 VVSDKQAVPNPTIPKDQTACSFLSNE-RNPDEGSTSQQKKPDGSSVVQCEVPQVVLEXXX 393 V SD + ++ +D + C N ++ D S + P G++ + VL Sbjct: 391 VYSDNRPQSTASVTEDLSRCLIRDNNLKSQDSASVGASRIPQGAAARPGKAVGSVLRYGN 450 Query: 394 XXXXXXXXXRIKNLKTLSCANFNFASSKLADRSTSESRTCLKESPGIESVVDSHLLLPKP 453 + + A +S L ++TC E+ +E + S PKP Sbjct: 451 CSTSAAEQQYEQRRVVRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKP 510 Query: 454 ETSNFLSPDTLSHRGGN 470 +N L P T+ R G+ Sbjct: 511 YVANKL-PATVDGRSGH 526 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.134 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,038,099 Number of Sequences: 37544 Number of extensions: 1259164 Number of successful extensions: 2496 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2495 Number of HSP's gapped (non-prelim): 2 length of query: 1061 length of database: 14,793,348 effective HSP length: 90 effective length of query: 971 effective length of database: 11,414,388 effective search space: 11083370748 effective search space used: 11083370748 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -