BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000704-TA|BGIBMGA000704-PA|IPR005123|2OG-Fe(II) oxygenase, IPR001006|Procollagen-lysine 5-dioxygenase, IPR006620|Prolyl 4-hydroxylase, alpha subunit (271 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 26 1.00 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 9.3 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 26.2 bits (55), Expect = 1.00 Identities = 13/29 (44%), Positives = 16/29 (55%) Query: 101 FPLMSDRFCDEWIAIMEAYGKWSDGTNND 129 F L S C+EWIA E + K S N+D Sbjct: 73 FQLQSAYHCNEWIAGNECHLKCSSLVNDD 101 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 9.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Query: 96 TDVYWFPLMSDRF---CDEWIAIMEAYGKWSD 124 T + PL +DR+ C EW A+MEA ++D Sbjct: 168 TVAIFVPLPADRWPRVC-EWFAVMEALPYYND 198 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.138 0.446 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 330,072 Number of Sequences: 2123 Number of extensions: 14062 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 2 length of query: 271 length of database: 516,269 effective HSP length: 63 effective length of query: 208 effective length of database: 382,520 effective search space: 79564160 effective search space used: 79564160 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -