BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000702-TA|BGIBMGA000702-PA|IPR001965|Zinc finger, PHD-type, IPR002219|Protein kinase C, phorbol ester/diacylglycerol binding, IPR011011|Zinc finger, FYVE/PHD-type (195 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 34 0.002 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 27 0.28 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 24 3.5 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 4.6 DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. 23 6.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.1 EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 23 8.0 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 34.3 bits (75), Expect = 0.002 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 1 MVCAYCHRTLRHAESIKCC-FCESKYHTKCMNETAKSICE-GGDRGYQWKCAVCQK 54 M C+ C+ A S+ C C SK+HT C + S E G + W C C + Sbjct: 35 MQCSTCNAPTDSANSVSCAGVCGSKHHTHCTGLSRDSTRELGRNNQLLWLCKNCNE 90 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 27.5 bits (58), Expect = 0.28 Identities = 8/29 (27%), Positives = 15/29 (51%) Query: 2 VCAYCHRTLRHAESIKCCFCESKYHTKCM 30 +C CH+ L ++C C+ H +C+ Sbjct: 338 LCQQCHKALHLDIGLRCVVCDFTCHQQCV 366 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.8 bits (49), Expect = 3.5 Identities = 13/55 (23%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Query: 2 VCAYCHRTLRHAESI-KCCFCESKYHTKCMN---ETAKSICEGGDRGYQWKCAVC 52 +C C L I C +C++ +H C E ++ D W C C Sbjct: 15 ICFSCAEPLEATGCIISCAYCDATFHRGCCKLPPELIDAVLSNVD--LHWSCIGC 67 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.4 bits (48), Expect = 4.6 Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Query: 17 KCCFCESKYHTKCMNETAKSICEGGDRGYQWKCAVCQKSATKLSNEVQNSKEINIENTLN 76 K C +Y C+ T C G + +KC S + ++ + ++ +I++ N N Sbjct: 92 KTCALNGEY---CL--THMECCSGNCLTFSYKCVPLSPSDSAMTGPLYSTPQISMVNFTN 146 Query: 77 LLSEK 81 + ++ Sbjct: 147 RIGDE 151 >DQ974160-1|ABJ52800.1| 235|Anopheles gambiae serpin 1 protein. Length = 235 Score = 23.0 bits (47), Expect = 6.1 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 9/42 (21%) Query: 53 QKSATKLSNEVQNSK-------EINIENTLNLLSEKFELVNK 87 ++S TK NEVQ SK EIN + TL + + +LVNK Sbjct: 154 KQSTTK--NEVQVSKMLQKAGIEINEKGTLAFAATEIQLVNK 193 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 6.1 Identities = 9/36 (25%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Query: 91 PKLHNELAHVKLVTERIDKQNEQILHEIDEIKTKLN 126 PK +++H T+ ++ + + + +DE+KT++N Sbjct: 3252 PKRDQQVSH----TDMVEYEKKMLYCRLDEMKTQIN 3283 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 22.6 bits (46), Expect = 8.0 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 7/36 (19%) Query: 59 LSNEVQNSK-------EINIENTLNLLSEKFELVNK 87 + NEVQ SK EIN + TL + + +LVNK Sbjct: 344 IKNEVQVSKMLQKAGIEINEKGTLAFAATEIQLVNK 379 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.131 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,020 Number of Sequences: 2123 Number of extensions: 7293 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 7 length of query: 195 length of database: 516,269 effective HSP length: 61 effective length of query: 134 effective length of database: 386,766 effective search space: 51826644 effective search space used: 51826644 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -