BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000701-TA|BGIBMGA000701-PA|IPR011614|Catalase, N-terminal, IPR002226|Catalase (507 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 5.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 5.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 5.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 5.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 5.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 5.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 5.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 5.0 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 8.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 8.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 8.7 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 8.7 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 12 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 71 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 72 LSTNGAPPRSTP 83 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 5.0 Identities = 18/72 (25%), Positives = 27/72 (37%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL + +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 325 AEVEQIAFSPSNLVPGIEPSPD 346 A++ ++A SP++ P EP P+ Sbjct: 20 AKIVKVAASPTSANPDEEPDPE 41 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 325 AEVEQIAFSPSNLVPGIEPSPD 346 A++ ++A SP++ P EP P+ Sbjct: 20 AKIVKVAASPTSANPDEEPDPE 41 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 8.7 Identities = 18/72 (25%), Positives = 26/72 (36%), Gaps = 7/72 (9%) Query: 339 PGIEPSPDKMLQGRLFAYSDTHRHRLGANYLQIP-------VNCPYKVAVSTYQRDGPQA 391 P P+P LQ + Y+ RL +LQ P +C Y + S+ PQ Sbjct: 56 PYAAPAPGHGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQD 115 Query: 392 IHNQDDCPNYFP 403 + P P Sbjct: 116 LSTNGAPPRSTP 127 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 8.7 Identities = 12/51 (23%), Positives = 20/51 (39%) Query: 295 FDLTKIWPHAEYPLIPVGKLVLDRNPKNYFAEVEQIAFSPSNLVPGIEPSP 345 F + W E P P + P+ + E + + + GI+PSP Sbjct: 125 FTTERNWEIREKPYTPPRLPTVYGKPEQNYEVDESASVMTNGRIHGIQPSP 175 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.137 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,453 Number of Sequences: 317 Number of extensions: 6230 Number of successful extensions: 19 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 12 length of query: 507 length of database: 114,650 effective HSP length: 60 effective length of query: 447 effective length of database: 95,630 effective search space: 42746610 effective search space used: 42746610 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -