BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000696-TA|BGIBMGA000696-PA|IPR001849|Pleckstrin-like, IPR001895|Guanine-nucleotide dissociation stimulator CDC25, IPR008937|Ras guanine nucleotide exchange factor (576 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 26 0.82 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 1.9 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 25.8 bits (54), Expect = 0.82 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Query: 117 PCFKAIKPEELTTCGWTKLNKL-TVAPNVVAFTKRFNR 153 P K + P+E T WT++N V+P+ F R Sbjct: 46 PTSKLVPPDERITYSWTEINAFANVSPSKTKFFNLIKR 83 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.6 bits (51), Expect = 1.9 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Query: 117 PCFKAIKPEELTTCGWTKLNKL-TVAPNVVAFTKRFNR 153 P K + P+E T WT++N V+P F R Sbjct: 46 PTSKLVPPDERITYSWTEINAFANVSPPKTKFFNLIKR 83 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.132 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,618 Number of Sequences: 317 Number of extensions: 6547 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 576 length of database: 114,650 effective HSP length: 60 effective length of query: 516 effective length of database: 95,630 effective search space: 49345080 effective search space used: 49345080 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -