BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000695-TA|BGIBMGA000695-PA|IPR001395|Aldo/keto reductase (262 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 25 0.77 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 5.4 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 24.6 bits (51), Expect = 0.77 Identities = 12/36 (33%), Positives = 16/36 (44%) Query: 149 HPYYTQSSLYKFCKQHHITLQAYCSFGGTSCSNNSL 184 +PY SS+YK H+ A SC N +L Sbjct: 180 NPYCFNSSVYKVFPVEHLLFIANAFITSQSCENATL 215 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/46 (21%), Positives = 19/46 (41%) Query: 189 VVVSTALKLEVTPAQVLLVWALQQDVAVIPKAVHPEHIKENRSLNF 234 V V+ + TP ++ W + I + + P H E + +F Sbjct: 93 VAVTVLAGILTTPFKLPYFWKMLTGFGKIEQVLPPHHAPEEKKRSF 138 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,895 Number of Sequences: 317 Number of extensions: 2707 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 262 length of database: 114,650 effective HSP length: 56 effective length of query: 206 effective length of database: 96,898 effective search space: 19960988 effective search space used: 19960988 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -