BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000691-TA|BGIBMGA000691-PA|undefined (1257 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 26 1.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 5.1 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 26.2 bits (55), Expect = 1.7 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Query: 526 SQNGLQGPGGQYAPTNTDGQIPGVQYNPGSTVGHNGLPIPGGLYNSGIGGG 576 +Q Q G +P +T P Y+P S +G + L PG L G G Sbjct: 122 TQQQQQHNNGYASPMSTSSYDP---YSPNSKIGRDELSQPGSLNGYGSSDG 169 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.6 bits (51), Expect = 5.1 Identities = 16/75 (21%), Positives = 31/75 (41%), Gaps = 1/75 (1%) Query: 1060 VDPNSALLIDGDDSAAEASVSQASNGTTAIASSKGGNDKGRAQTHVQGAYTGGGSFSAQA 1119 +D + L +D E ++ T+ + G ++ Q+ + G Y S A Sbjct: 810 IDKENILFLDLSTGKVEM-ITGVGKATSPNLTKWGNPNRPIVQSGIFGKYMVSPSNDALF 868 Query: 1120 EISGENKAANSEVTG 1134 ++GE + N E+ G Sbjct: 869 VLNGETRTINCEIGG 883 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.306 0.132 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,187 Number of Sequences: 429 Number of extensions: 18038 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 1257 length of database: 140,377 effective HSP length: 66 effective length of query: 1191 effective length of database: 112,063 effective search space: 133467033 effective search space used: 133467033 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.9 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -