BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000688-TA|BGIBMGA000688-PA|IPR004481|K+-dependent Na+/Ca+ exchanger related-protein, IPR004837|Sodium/calcium exchanger membrane region (427 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 25 1.0 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 4.1 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 25.0 bits (52), Expect = 1.0 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 300 ILWATIPDCRHRHSIYPLTFIMCITWIGSVSYLVAWIITV 339 +L AT D RH+ YPLT+ + V +AW+ ++ Sbjct: 130 VLMATAID-RHQAICYPLTYCSWTSRRSKVMVYLAWVASL 168 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 4.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 145 NCVGTFVTEGDLGVGAVVGSAVFNVLAVPACCALFAG 181 + V F+T GDL + G VF L + A ++ AG Sbjct: 372 HAVACFLTRGDLWLSWEEGMKVFEELLLDADWSVNAG 408 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.327 0.141 0.449 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,322 Number of Sequences: 317 Number of extensions: 4414 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 427 length of database: 114,650 effective HSP length: 59 effective length of query: 368 effective length of database: 95,947 effective search space: 35308496 effective search space used: 35308496 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -