GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000686-TA|BGIBMGA000686-PA|IPR005399|KCNAB voltage-gated
K+ channel, beta subunit, IPR001395|Aldo/keto reductase
         (529 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   6.3  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 23.0 bits (47), Expect = 6.3
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 442  CLKNESVNCLLLGATSVEQFKENIHALQVYIKKIFKVCVKSFKLLQQSPLRF 493
            CL +  + C+L  +T      E +HA     +++  V  ++F L + S   F
Sbjct: 1098 CLHHRDLPCVLRASTPAPVVLEAVHA----SRRVLIVLTRNFLLTEWSRFEF 1145


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.320    0.135    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 151,716
Number of Sequences: 429
Number of extensions: 6643
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 2
length of query: 529
length of database: 140,377
effective HSP length: 61
effective length of query: 468
effective length of database: 114,208
effective search space: 53449344
effective search space used: 53449344
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)