Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000685-TA|BGIBMGA000685-PA|undefined
         (190 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   6.3  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 11/43 (25%), Positives = 16/43 (37%)

Query: 141 GPCRDQSIDSDCCENPGCTASTETRTWRASTSDVNPRRRIDFV 183
           G CR        C+ P  T  T       +  D NP + +D +
Sbjct: 389 GVCRISDGGGYICDCPSGTNGTNCEIDTINECDSNPCKHLDAI 431


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.131    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,537
Number of Sequences: 317
Number of extensions: 1392
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 190
length of database: 114,650
effective HSP length: 53
effective length of query: 137
effective length of database: 97,849
effective search space: 13405313
effective search space used: 13405313
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 41 (20.6 bits)