BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000681-TA|BGIBMGA000681-PA|IPR004145|Protein of unknown function DUF243 (489 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 2.5 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.2 bits (50), Expect = 2.5 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 5/44 (11%) Query: 9 REAINDSIGPILGFT-----LAVALADVSHLGYDYKAPQTSYGY 47 +++ D IG + G T +A AD L YK+PQ +GY Sbjct: 41 QDSDGDGIGDLNGITARMDHIADIGADALWLSPIYKSPQVDFGY 84 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.131 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,344 Number of Sequences: 429 Number of extensions: 3797 Number of successful extensions: 10 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 1 length of query: 489 length of database: 140,377 effective HSP length: 60 effective length of query: 429 effective length of database: 114,637 effective search space: 49179273 effective search space used: 49179273 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -