SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000681-TA|BGIBMGA000681-PA|IPR004145|Protein of unknown
function DUF243
         (489 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098)                29   6.4  

>SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098)
          Length = 620

 Score = 29.5 bits (63), Expect = 6.4
 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query: 7  KHREAINDSIGPI------LGFTLAVALADVSHLGYDYKAPQTSYGYPSYQLGESSSHQ 59
          KHRE +N +IG +      L  T       +++L       QT   Y + QLG   +H+
Sbjct: 7  KHRERLNSNIGSMNGENNRLSITATTTQGSINNLHRQIPQNQTKGSYNNLQLGAGQAHE 65


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.312    0.131    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,080,128
Number of Sequences: 59808
Number of extensions: 341698
Number of successful extensions: 697
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 696
Number of HSP's gapped (non-prelim): 1
length of query: 489
length of database: 16,821,457
effective HSP length: 85
effective length of query: 404
effective length of database: 11,737,777
effective search space: 4742061908
effective search space used: 4742061908
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 62 (29.1 bits)

- SilkBase 1999-2023 -