GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000681-TA|BGIBMGA000681-PA|IPR004145|Protein of unknown
function DUF243
         (489 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase pro...    24   2.5  

>AB253416-1|BAE86927.1|  580|Apis mellifera alpha-glucosidase
          protein.
          Length = 580

 Score = 24.2 bits (50), Expect = 2.5
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query: 9  REAINDSIGPILGFT-----LAVALADVSHLGYDYKAPQTSYGY 47
          +++  D IG + G T     +A   AD   L   YK+PQ  +GY
Sbjct: 41 QDSDGDGIGDLNGITARMDHIADIGADALWLSPIYKSPQVDFGY 84


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.312    0.131    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,344
Number of Sequences: 429
Number of extensions: 3797
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 1
length of query: 489
length of database: 140,377
effective HSP length: 60
effective length of query: 429
effective length of database: 114,637
effective search space: 49179273
effective search space used: 49179273
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 46 (22.6 bits)