BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000680-TA|BGIBMGA000680-PA|IPR008147|Glutamine synthetase, beta-Grasp, IPR008146|Glutamine synthetase, catalytic region (422 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 1.2 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 6.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.0 bits (52), Expect = 1.2 Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 290 EEYGVIVTFDPKPVQDWNG 308 +++ + VT+ P P +DWNG Sbjct: 989 DQHTLKVTWKPPPREDWNG 1007 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.6 bits (46), Expect = 6.5 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Query: 366 ASINDFSAGVANRGSSIRIPRSVAEDKKGYLEDRRPASNCDP 407 A+ DFS GV N S ++ + ++ LED C+P Sbjct: 206 ATPTDFSMGVKNNHVSSKVEGNGVHEENSPLEDN---IKCEP 244 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.136 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,105 Number of Sequences: 429 Number of extensions: 6672 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 422 length of database: 140,377 effective HSP length: 59 effective length of query: 363 effective length of database: 115,066 effective search space: 41768958 effective search space used: 41768958 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -