BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000678-TA|BGIBMGA000678-PA|undefined (411 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 27 0.24 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.0 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 27.1 bits (57), Expect = 0.24 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 9 QNVTEFIDERTLCVTILPKVR-IIFENNQTDHKVVFLVLAYFERLLPRLERTHLLEHIIP 67 QN+ + E + ILP V+ ++ + NQ + V+ L P L R + +EH++P Sbjct: 313 QNLDKAHQESIIMNNILPCVKELVADPNQHVKSALASVIM---GLSPILGRHNTIEHLLP 369 Query: 68 TLLT-LKLGDPEI 79 LT LK PE+ Sbjct: 370 LFLTQLKDECPEV 382 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 3.0 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 282 RRHSSIGPQERRGSTVNLSPPTGGSVPNTSS-SVPFLL 318 + S PQ+R S +LS G +VP +++ S P +L Sbjct: 692 QNEKSPSPQQRSPSVTDLSTKDGTTVPESNNGSSPSVL 729 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.131 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,522 Number of Sequences: 317 Number of extensions: 2481 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 411 length of database: 114,650 effective HSP length: 58 effective length of query: 353 effective length of database: 96,264 effective search space: 33981192 effective search space used: 33981192 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -