BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000674-TA|BGIBMGA000674-PA|IPR001873|Na+ channel, amiloride-sensitive (317 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0074 - 27509124-27509199,27509613-27512143 31 0.92 01_01_1165 - 9267891-9268145,9268395-9268510,9268991-9269127,926... 31 1.2 01_04_0020 + 15142402-15143421 31 1.6 10_08_0356 + 17141107-17141165,17141502-17141650,17141748-171419... 28 8.6 10_07_0080 - 12704866-12705224,12705389-12705512,12705905-127060... 28 8.6 >05_07_0074 - 27509124-27509199,27509613-27512143 Length = 868 Score = 31.5 bits (68), Expect = 0.92 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Query: 21 TPLPRRVASCGYQTALTVLIKTDPLDYYSASVASQGVLV-FIDDSYNLPDLDSPVRMVNP 79 +PL +VA T ++ KTDPL + +AS G+ + +D+S DL+S + +++ Sbjct: 565 SPLDTKVAQHVKGTIRSLRKKTDPLFFEPLDIASYGLYIDKVDESMWRMDLESTMALISM 624 Query: 80 S-SEVFIAL 87 + S +FIA+ Sbjct: 625 TLSCLFIAV 633 >01_01_1165 - 9267891-9268145,9268395-9268510,9268991-9269127, 9269645-9269808,9269892-9269972,9270783-9270962, 9271489-9271929,9273234-9273344,9274355-9274463, 9274618-9274643,9274823-9274903,9275013-9275211, 9275374-9275449,9275553-9275769,9276117-9276155, 9276684-9276783,9276962-9277084,9277171-9277895 Length = 1059 Score = 31.1 bits (67), Expect = 1.2 Identities = 26/98 (26%), Positives = 37/98 (37%), Gaps = 1/98 (1%) Query: 17 VLVNTPLPRRVASCGYQTALTVLIKTDPLDYYSASVASQGVLVFIDDSYNLPDLDSPVRM 76 VL T LP V + A ++ DP +Y S+ S L + + D P Sbjct: 27 VLCGTGLPESVLAAACAAAGKTVLHVDPNPFY-GSLFSSLPLPSLPSFLSPSPSDDPAPS 85 Query: 77 VNPSSEVFIALSPERTYSTPGVKGFPPEQRQCYFKDEV 114 +PSS + L YS G PE + + D V Sbjct: 86 PSPSSAAAVDLRRRSPYSEVETSGAVPEPSRRFTADLV 123 >01_04_0020 + 15142402-15143421 Length = 339 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/46 (32%), Positives = 20/46 (43%) Query: 62 DDSYNLPDLDSPVRMVNPSSEVFIALSPERTYSTPGVKGFPPEQRQ 107 D+ + SPV P S +A P Y P G+PP Q+Q Sbjct: 216 DEKATEKSVSSPVTAYPPPSNAVVAHPPVVPYGAPYGGGYPPHQQQ 261 >10_08_0356 + 17141107-17141165,17141502-17141650,17141748-17141969, 17142051-17142187,17142319-17142570,17143915-17144063, 17144476-17144540,17144633-17144701,17145014-17145144, 17145218-17145505,17145669-17145811,17145898-17145951, 17146000-17146080,17149048-17149222,17149223-17149647, 17149929-17150144,17150279-17150309 Length = 881 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 255 IFLVLHVFYGLIQIIFVYKNKYVQKINVQERNS 287 ++ +LHVFY I +Y + ++ I +Q R+S Sbjct: 630 VYYILHVFYYFITHFLLYFSDFISLIIIQVRSS 662 >10_07_0080 - 12704866-12705224,12705389-12705512,12705905-12706041, 12707971-12708106,12710346-12710759 Length = 389 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 21 TPLPRRVASCGYQTALTVLIKTDPLDYYSASVASQGVLVF 60 TPLP R +SC + + P D S S+A GV F Sbjct: 39 TPLPARPSSCNSNDGVAAAVMPSPED-LSQSLAGSGVEAF 77 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.140 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,448,130 Number of Sequences: 37544 Number of extensions: 392903 Number of successful extensions: 899 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 895 Number of HSP's gapped (non-prelim): 6 length of query: 317 length of database: 14,793,348 effective HSP length: 82 effective length of query: 235 effective length of database: 11,714,740 effective search space: 2752963900 effective search space used: 2752963900 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -