BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000674-TA|BGIBMGA000674-PA|IPR001873|Na+ channel, amiloride-sensitive (317 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ252011-1|CAB85607.1| 505|Homo sapiens amiloride-sensitive sod... 41 0.005 >AJ252011-1|CAB85607.1| 505|Homo sapiens amiloride-sensitive sodium channel protein. Length = 505 Score = 41.1 bits (92), Expect = 0.005 Identities = 42/182 (23%), Positives = 73/182 (40%), Gaps = 24/182 (13%) Query: 114 VKIANFRQYSFHNCIVYRKLKSIKDACNCAPFFL-SKGPK-----------------SIK 155 +K+ NF YS C+ K + IK C C PF L G + K Sbjct: 302 IKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSCVSPVLDHIEFK 361 Query: 156 NHNTTLVDDLHCLPECEHFDYPLEVALGKLASNMHL----NRLPFFNEVDLVNQSVLNVF 211 + T + C CE +YP ++ S L +L + N + + Sbjct: 362 DLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEIN 421 Query: 212 FNDLVSTRYRRDVYLNWQNILAAFGGLLSLMLGFTLISGFDLVIFLVLHVFYGLIQIIFV 271 ++DL ++ ++ +LA GG L L G +LI+ +++ +L + ++ I I F+ Sbjct: 422 YSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYW--ICIFFL 479 Query: 272 YK 273 K Sbjct: 480 LK 481 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.324 0.140 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,473,150 Number of Sequences: 224733 Number of extensions: 2107260 Number of successful extensions: 5222 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5219 Number of HSP's gapped (non-prelim): 2 length of query: 317 length of database: 73,234,838 effective HSP length: 90 effective length of query: 227 effective length of database: 53,008,868 effective search space: 12033013036 effective search space used: 12033013036 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -