GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000667-TA|BGIBMGA000667-
PA|IPR004825|Insulin/IGF/relaxin, IPR004824|Bombyxin,
IPR003234|Insulin-related peptide
         (131 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    22   2.6  

>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 21.8 bits (44), Expect = 2.6
 Identities = 10/36 (27%), Positives = 18/36 (50%)

Query: 28  VVALVSADVHDKELKIEENPRVYCGRHLANARMVLC 63
           +  ++  +V DK +K E+N  +   R L     +LC
Sbjct: 269 IPTVLDRNVIDKWIKTEDNESLNAARMLIRQEGLLC 304


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.324    0.137    0.418 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,509
Number of Sequences: 429
Number of extensions: 1300
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 131
length of database: 140,377
effective HSP length: 51
effective length of query: 80
effective length of database: 118,498
effective search space:  9479840
effective search space used:  9479840
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 40 (20.2 bits)