BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000666-TA|BGIBMGA000666-PA|IPR001251|Cellular retinaldehyde-binding/triple function, C-terminal, IPR011074|Phosphatidylinositol transfer protein-like, N-terminal (263 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.2 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.6 bits (46), Expect = 3.1 Identities = 15/66 (22%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Query: 193 PTLYGGKLELREMIEYTKQILKEQKEN---VLALDNMEILSTRGIISSRGXXXXXXXXED 249 P Y K R + +TK ++ E++EN ++ + E+ + + ++ E Sbjct: 236 PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRRLAMLDLLLTAKNKEG 295 Query: 250 LISVEG 255 LI EG Sbjct: 296 LIDDEG 301 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.6 bits (46), Expect = 3.1 Identities = 15/66 (22%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Query: 193 PTLYGGKLELREMIEYTKQILKEQKEN---VLALDNMEILSTRGIISSRGXXXXXXXXED 249 P Y K R + +TK ++ E++EN ++ + E+ + + ++ E Sbjct: 236 PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVYTGKRRLAMLDLLLTAKNKEG 295 Query: 250 LISVEG 255 LI EG Sbjct: 296 LIDDEG 301 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 199 KLELREMIEYTKQILKEQKENVL 221 +L + E ++YTK ++ Q N+L Sbjct: 767 RLGIDESVDYTKPLVDAQTMNLL 789 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.393 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,765 Number of Sequences: 317 Number of extensions: 2034 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 263 length of database: 114,650 effective HSP length: 56 effective length of query: 207 effective length of database: 96,898 effective search space: 20057886 effective search space used: 20057886 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -