GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000666-TA|BGIBMGA000666-PA|IPR001251|Cellular
retinaldehyde-binding/triple function, C-terminal,
IPR011074|Phosphatidylinositol transfer protein-like, N-terminal
         (263 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex det...    22   6.5  

>AY569694-1|AAS86647.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 12/43 (27%), Positives = 18/43 (41%)

Query: 16  VTIEKAENDGKMGRTLKNVVAEAITELRETQSTKEQSLQLMRE 58
           V IEK+EN+ K   T  N +       + T S   +     R+
Sbjct: 187 VNIEKSENESKKYATSSNSLRNRTHGFQHTSSRYSRERSCSRD 229


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.133    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,199
Number of Sequences: 429
Number of extensions: 2391
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 263
length of database: 140,377
effective HSP length: 57
effective length of query: 206
effective length of database: 115,924
effective search space: 23880344
effective search space used: 23880344
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)