SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000665-TA|BGIBMGA000665-PA|undefined
         (205 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       21   5.3  

>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 68  IDVVNNFGLNYNLNEEQLNALAARVREDYAG 98
           IDV + F   Y L +      A R+ ED++G
Sbjct: 223 IDVFSKFLKLYPLRKATAKIAAKRLIEDFSG 253


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.132    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 49,461
Number of Sequences: 317
Number of extensions: 1914
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 205
length of database: 114,650
effective HSP length: 54
effective length of query: 151
effective length of database: 97,532
effective search space: 14727332
effective search space used: 14727332
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 41 (20.6 bits)

- SilkBase 1999-2023 -