BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000665-TA|BGIBMGA000665-PA|undefined (205 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0426 + 3239274-3239386,3239472-3239702,3242516-3242642,324... 30 1.2 03_03_0144 + 14826797-14827435,14827561-14827771,14827861-148281... 29 3.5 >07_01_0426 + 3239274-3239386,3239472-3239702,3242516-3242642, 3242729-3242788,3242868-3242960,3243073-3243369, 3243450-3243761,3243857-3244114,3244227-3244375, 3244470-3245102,3245367-3245640,3245736-3245777, 3246332-3246586,3246700-3246711 Length = 951 Score = 30.3 bits (65), Expect = 1.2 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 9/101 (8%) Query: 11 AHLGKEE--LSKDAAQFIWQTLVTHHEGIANIPNNVLMNLHWVTTAVMPEDYANITLSNI 68 AH+ + E L +F + T + PN +L+N+HW AV Y L ++ Sbjct: 663 AHMEEFEFYLINGRGEFQQTRIQTDEVDLQTTPNRLLINVHWQQNAV--GQYDTSMLKSL 720 Query: 69 DVVNNFGLNYNLNEEQL---NALAARVREDYAGKEPEDYTY 106 ++ L NE+ + L A ++E+ G PED Y Sbjct: 721 PEIHKLELIPKGNEDSVALHGCLEAFLKEEPLG--PEDMWY 759 >03_03_0144 + 14826797-14827435,14827561-14827771,14827861-14828155, 14828285-14828674,14829131-14829208,14829296-14829518 Length = 611 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 17 ELSKDAAQFIWQTLVTHHEGIANIPNNVL--MNLHWV 51 ++ K A WQT +T HEG ++P +L + +WV Sbjct: 569 KVEKIANAMRWQTRLTDHEGGPHVPEKILFAVKQYWV 605 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,593,794 Number of Sequences: 37544 Number of extensions: 205420 Number of successful extensions: 433 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 432 Number of HSP's gapped (non-prelim): 2 length of query: 205 length of database: 14,793,348 effective HSP length: 79 effective length of query: 126 effective length of database: 11,827,372 effective search space: 1490248872 effective search space used: 1490248872 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -