BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000664-TA|BGIBMGA000664-PA|IPR008506|Protein of unknown function DUF788 (176 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.17 |pof8||F-box protein Pof8|Schizosaccharomyces pombe|... 31 0.13 SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MB... 30 0.22 SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosa... 27 1.6 SPCC31H12.02c |mug73||membrane transporter |Schizosaccharomyces ... 26 2.7 SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizo... 25 8.4 SPAC17H9.18c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.4 >SPAC17G6.17 |pof8||F-box protein Pof8|Schizosaccharomyces pombe|chr 1|||Manual Length = 402 Score = 30.7 bits (66), Expect = 0.13 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query: 41 IITALFYYENISNWVLFFNVLVLIIHIACYQLMMYISK-PRYLNNTQLLDPG 91 + ALF+++N S+ V+ +VL + I Y ++Y+ P L+N LL G Sbjct: 122 VTNALFHFDNSSHMVIRNENIVLPLDIPLYDRIIYVEPVPATLSNKSLLLAG 173 >SPAC24H6.01c ||SPAPB21F2.01|membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 1|||Manual Length = 588 Score = 29.9 bits (64), Expect = 0.22 Identities = 14/41 (34%), Positives = 27/41 (65%), Gaps = 4/41 (9%) Query: 54 WVLFFNVLVLIIHIACYQLMMYISKPR---YLNNTQLLDPG 91 ++ +F+V++ I+ IAC+++ Y+S P+ Y N + L PG Sbjct: 59 FIFYFSVILSILTIACFKI-HYVSSPKHPNYKNIEKYLKPG 98 >SPBC530.15c ||SPBC661.01|spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 516 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 129 LILPIRVFWLLWTNILGPWFFQEAP 153 ++ PI +FWL WT PW P Sbjct: 394 IVFPIGIFWLAWTGNY-PWIHWIVP 417 >SPCC31H12.02c |mug73||membrane transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 306 Score = 26.2 bits (55), Expect = 2.7 Identities = 8/38 (21%), Positives = 22/38 (57%) Query: 29 RNMSMAATSFYGIITALFYYENISNWVLFFNVLVLIIH 66 +N+ +A+ F + + YY W++ F ++++++H Sbjct: 81 KNVFSSASFFREVSVRMVYYVRYIQWLINFPLIIVMLH 118 >SPBC1271.02 |stt3||oligosaccharyltransferase subunit Stt3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 24.6 bits (51), Expect = 8.4 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 34 AATSFYGIITALFYYENISNWVLFFNVLVLI-IHIACYQLM-MYISK 78 + +SF+G T L Y+ ++ W + + +I +H+ LM Y SK Sbjct: 195 SGSSFWGACTGLLYFYMVTAWGGYVFITNMIPLHVFVLLLMGRYTSK 241 >SPAC17H9.18c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 105 Score = 24.6 bits (51), Expect = 8.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Query: 102 EHIKDIVILSSITQVLALINNYFWLLLL-----ILPIRVFWLL 139 +H+K+I L S + L L +NY LL+ PIR F+++ Sbjct: 61 QHLKEIHYLISASAKLLLASNYLLELLISHNIQFSPIRSFFII 103 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.331 0.144 0.456 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,220 Number of Sequences: 5004 Number of extensions: 24883 Number of successful extensions: 79 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 76 Number of HSP's gapped (non-prelim): 6 length of query: 176 length of database: 2,362,478 effective HSP length: 68 effective length of query: 108 effective length of database: 2,022,206 effective search space: 218398248 effective search space used: 218398248 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -