BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000661-TA|BGIBMGA000661-PA|IPR013766|Thioredoxin domain,
IPR012336|Thioredoxin-like fold, IPR000886|Endoplasmic reticulum
targeting sequence, IPR006662|Thioredoxin-related,
IPR005788|Disulphide isomerase
(632 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 27 0.62
>DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein
protein.
Length = 486
Score = 26.6 bits (56), Expect = 0.62
Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
Query: 238 RQAIVEFMRDPVAQPKQKKKDVVDESWARDTDVVHLN-GDSF 278
R + +R VA+ + ++K+V+D + D D V+L G SF
Sbjct: 431 RSEYLNHLRANVAEGRNQRKNVLDRLFRMDRDAVYLQPGMSF 472
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.320 0.135 0.405
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,641
Number of Sequences: 429
Number of extensions: 7324
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 1
length of query: 632
length of database: 140,377
effective HSP length: 62
effective length of query: 570
effective length of database: 113,779
effective search space: 64854030
effective search space used: 64854030
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)
- SilkBase 1999-2023 -