BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000660-TA|BGIBMGA000660-PA|IPR009984|Geminin (161 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 26 0.21 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 2.6 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 25.8 bits (54), Expect = 0.21 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Query: 45 IVTKKKNSSKSIQ-VNLDKWISENDLCLEVPSETYWKVVAEKRRKALAEALNENEILHKS 103 IV K ++ + I + + K IS N E + Y +V+ K +K LN NE+ + Sbjct: 340 IVAKNNDTLQFISGIKIIKQISSN--IYERQNNEYIWIVSNKYQKIANGDLNFNEVNFRI 397 Query: 104 LSLLTEENLKYKKLLDEANSFIEV 127 L+ + ++Y + + +F + Sbjct: 398 LNAPVNQLIRYTRCENPKTNFFSI 421 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 2.6 Identities = 13/48 (27%), Positives = 20/48 (41%) Query: 7 EESKINSNTATTILKSVDKDLLAGRKKGSIKEYFSPRNIVTKKKNSSK 54 +E+ + N ILKS+ L G + P+NI+ K K Sbjct: 148 DEAILIKNERICILKSITCALQFCHNAGIVHADVKPKNILMSKNGQPK 195 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.307 0.126 0.342 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,827 Number of Sequences: 429 Number of extensions: 1796 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 161 length of database: 140,377 effective HSP length: 53 effective length of query: 108 effective length of database: 117,640 effective search space: 12705120 effective search space used: 12705120 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.2 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -