BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000658-TA|BGIBMGA000658-PA|undefined (179 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 25 0.47 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 3.3 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 24.6 bits (51), Expect = 0.47 Identities = 9/31 (29%), Positives = 19/31 (61%) Query: 45 LDNSDCQDSETVVLPEYTESIQPSREKELRH 75 LDN +++E +V P+ + +R+ +L+H Sbjct: 207 LDNMQKREAEKIVRPDLIHLLMEARKGKLKH 237 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.8 bits (44), Expect = 3.3 Identities = 5/14 (35%), Positives = 10/14 (71%) Query: 157 LVIPAGCECMWPVY 170 ++I GC C+W ++ Sbjct: 48 VIITIGCLCIWSIF 61 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.132 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,211 Number of Sequences: 317 Number of extensions: 1798 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 179 length of database: 114,650 effective HSP length: 53 effective length of query: 126 effective length of database: 97,849 effective search space: 12328974 effective search space used: 12328974 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -