BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000654-TA|BGIBMGA000654-PA|undefined (420 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 25 1.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 1.8 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.6 bits (51), Expect = 1.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Query: 330 PLSHNGTLAATGDDGKLRLIVPVS----PSESTSDVAEIHP 366 P ++N LAATG D + LI +S PS S + ++ P Sbjct: 509 PNTYNRFLAATGGDHVISLIDEISFTFPPSPPLSQIHDLSP 549 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.8 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Query: 353 SPSESTSDVAEIHPVESPSTSGHTLKVPGQVELLAPAAPITRTTSEKVPNRSEMMTALRS 412 +P ST ++ P S +T L P V P P T TTS+ + + + ++ S Sbjct: 121 APPRSTPPLST--PSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASSTSSTSS 178 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.310 0.125 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,264 Number of Sequences: 317 Number of extensions: 3207 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 420 length of database: 114,650 effective HSP length: 59 effective length of query: 361 effective length of database: 95,947 effective search space: 34636867 effective search space used: 34636867 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -