BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000652-TA|BGIBMGA000652-PA|undefined (233 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.7 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 8.2 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.2 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.7 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 16/119 (13%) Query: 57 EKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREYIGGARPRPLSVGAMKRYDKDIEDF 116 +++SH + RS E S + ++ SR+E + P + + + R D Sbjct: 794 QQQSHHYGRRERSGSESSSISERCSSRVESLTPERKM---EPPGVPLNSTPRSTPD---- 846 Query: 117 HGGSFIRDNSPLPNRRFDSSEEVCVQSRLVIPVMDRLGGHES--IGQEVTERPRKKLSF 173 R+ SP ++ ++ EV V+ + +RL H S I +E +R + SF Sbjct: 847 -----KREKSPTSDKAQEADGEVVVKKE--VDEEERLENHTSVKIKREAEDRDEDERSF 898 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 162 EVTERPRKKLSFREPCEVVGNANATLGRSSKL 193 EV RP + RE C+ V T+ +S L Sbjct: 128 EVNSRPETWVLGREMCKAVPFVELTVAHASVL 159 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Query: 162 EVTERPRKKLSFREPCEVVGNANATLGRSSKL 193 EV RP + RE C+ V T+ +S L Sbjct: 128 EVNSRPETWVLGREMCKAVPFVELTVAHASVL 159 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.128 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,595 Number of Sequences: 317 Number of extensions: 1699 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 233 length of database: 114,650 effective HSP length: 55 effective length of query: 178 effective length of database: 97,215 effective search space: 17304270 effective search space used: 17304270 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -