BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000652-TA|BGIBMGA000652-PA|undefined (233 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 27 0.20 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 26 0.34 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.34 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 26 0.34 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 25 0.45 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 0.45 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 0.45 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 25 0.45 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 0.45 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.45 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 0.45 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.45 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.45 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.45 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 25 0.45 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.45 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.45 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.45 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.45 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.45 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 0.45 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.45 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.45 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 25 0.45 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.4 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 2.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.2 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 23 3.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 3.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 3.2 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 26.6 bits (56), Expect = 0.20 Identities = 14/51 (27%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ SK D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.8 bits (54), Expect = 0.34 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLTKKMILEY 64 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.8 bits (54), Expect = 0.34 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 25.8 bits (54), Expect = 0.34 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIE 85 +E R + S+ +EKKS++ + R E S+ R + R E Sbjct: 264 EERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERE 307 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 Score = 23.4 bits (48), Expect = 1.8 Identities = 19/84 (22%), Positives = 33/84 (39%), Gaps = 1/84 (1%) Query: 9 KKRRNEHNLKNLPSEVLLKARNTVVSLSGALKPKEHQLRSKASKHDTKEKKSHEKLKNSR 68 KK NE K S L+ R + + +E + ++ K+ + +EKL N + Sbjct: 201 KKSGNESK-KYATSSNSLRNRTHDFQHTSSRYSRERRCSRDRNREYRKKDRQYEKLHNEK 259 Query: 69 SEPEFSEVRKKHRSRIEDGVSREY 92 + +K SR + R Y Sbjct: 260 EKLLEERTSRKRYSRSREREQRSY 283 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQHRREVWLIQQEREREHERLMKKMILEY 64 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ S+ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDSEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIE 85 +E R + S+ +EKKS++ + R E S+ R + R E Sbjct: 31 EERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERE 74 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIE 85 +E R + S+ +EKKS++ + R E S+ R + R E Sbjct: 31 EERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERE 74 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIE 85 +E R + S+ +EKKS++ + R E S+ R + R E Sbjct: 31 EERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERE 74 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIE 85 +E R + S+ +EKKS++ + R E S+ R + R E Sbjct: 31 EERTSRKRYSRSREREKKSYKNENSYRKYRETSKERSRDRKERE 74 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/51 (23%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ ++ D + + E+L++ R + R++ R+ + EY Sbjct: 14 KFKQLRNEDNEIDLRSRTKEERLQHRREAWLIQQEREREHQRLMKKMILEY 64 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 35 LSGALKPKEHQLRSKASKHDTKEKKSHEKLKNSRSE 70 L GA+ P ++ KA + + ++ S +KL+ S ++ Sbjct: 848 LLGAIVPVLESIQQKAKRSKSLQEVSSDKLQESSTD 883 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/36 (27%), Positives = 21/36 (58%) Query: 35 LSGALKPKEHQLRSKASKHDTKEKKSHEKLKNSRSE 70 L GA+ P ++ KA + + ++ S +KL+ S ++ Sbjct: 886 LLGAIVPVLESIQQKAKRSKSLQEVSSDKLQESSTD 921 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 106 MKRYDKDIEDFHGGSF 121 ++ YD+++EDF G F Sbjct: 295 LREYDRELEDFDGRLF 310 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 3.2 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Query: 6 DHSKKRR-NEHNLKNLPSEVLLKARNTVVSLSGALKPKEHQLRSKASKHDTKEKKSHEKL 64 +HSK R N +K + + L K R VSL G + L + K +T+E+K K Sbjct: 489 NHSKSSRINIERMKQVYQQ-LNKYRGNGVSLKGETVGLLNALPPSSMK-ETEEEKKKTKQ 546 Query: 65 KNSRSE 70 S SE Sbjct: 547 SLSPSE 552 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Query: 109 YDKDIEDFHGGSFIRDNSP 127 +D IED+HGG D P Sbjct: 65 FDPIIEDYHGGFKKTDKHP 83 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/51 (23%), Positives = 26/51 (50%) Query: 42 KEHQLRSKASKHDTKEKKSHEKLKNSRSEPEFSEVRKKHRSRIEDGVSREY 92 K QLR++ +K D + + E+L+ R + R++ +++ + EY Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEKLKRKMILEY 64 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Query: 109 YDKDIEDFHGGSFIRDNSP 127 +D IED+HGG D P Sbjct: 81 FDPIIEDYHGGFKKTDKHP 99 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.311 0.128 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,528 Number of Sequences: 429 Number of extensions: 2953 Number of successful extensions: 38 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of query: 233 length of database: 140,377 effective HSP length: 56 effective length of query: 177 effective length of database: 116,353 effective search space: 20594481 effective search space used: 20594481 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -