BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000651-TA|BGIBMGA000651-PA|IPR006020|Phosphotyrosine interaction region (140 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 3.1 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 3.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 60 FGRKNNQASETIEIMHHPIYRIFYVSHDSS 89 F R + E + + + + +IFYV DSS Sbjct: 579 FDRVKDLFLEAVLLRYPDLNKIFYVQTDSS 608 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.135 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,085 Number of Sequences: 317 Number of extensions: 873 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 140 length of database: 114,650 effective HSP length: 51 effective length of query: 89 effective length of database: 98,483 effective search space: 8764987 effective search space used: 8764987 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (21.0 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -