GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000651-TA|BGIBMGA000651-PA|IPR006020|Phosphotyrosine
interaction region
         (140 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    21   3.1  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 21.4 bits (43), Expect = 3.1
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 60  FGRKNNQASETIEIMHHPIYRIFYVSHDSS 89
           F R  +   E + + +  + +IFYV  DSS
Sbjct: 579 FDRVKDLFLEAVLLRYPDLNKIFYVQTDSS 608


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.323    0.135    0.387 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,085
Number of Sequences: 317
Number of extensions: 873
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 114,650
effective HSP length: 51
effective length of query: 89
effective length of database: 98,483
effective search space:  8764987
effective search space used:  8764987
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (21.0 bits)
S2: 39 (19.8 bits)