BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000651-TA|BGIBMGA000651-PA|IPR006020|Phosphotyrosine interaction region (140 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 20 8.6 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 6.5 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Query: 2 DVPRPTSRVEIVAAMRRVRYEFKARGVKKRKVIVDVSTDG 41 D +PT E++ +R+V +E G+ K D + DG Sbjct: 501 DAMKPTKGTELLKYLRKVDFE----GLSGDKFKFDKNGDG 536 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 20.2 bits (40), Expect = 8.6 Identities = 7/27 (25%), Positives = 15/27 (55%) Query: 74 MHHPIYRIFYVSHDSSDLKIFSYIARD 100 +H + +Y+ S+D+ SY++ D Sbjct: 261 LHKQVLNRYYLERLSNDMGEVSYVSLD 287 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.135 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,402 Number of Sequences: 429 Number of extensions: 1211 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 140 length of database: 140,377 effective HSP length: 52 effective length of query: 88 effective length of database: 118,069 effective search space: 10390072 effective search space used: 10390072 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -