BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000650-TA|BGIBMGA000650-PA|undefined (70 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001734-1|AAN71489.1| 698|Drosophila melanogaster RE71585p pro... 40 3e-04 AY075524-1|AAL68331.1| 698|Drosophila melanogaster RE71517p pro... 40 3e-04 AE014296-1687|AAF50246.2| 698|Drosophila melanogaster CG32048-P... 40 3e-04 BT001316-1|AAN71071.1| 690|Drosophila melanogaster AT15050p pro... 25 9.7 AY051535-1|AAK92959.1| 576|Drosophila melanogaster GH18690p pro... 25 9.7 AF115775-1|AAD29307.2| 686|Drosophila melanogaster Hsp90-relate... 25 9.7 AE013599-183|AAF57362.1| 691|Drosophila melanogaster CG3152-PA ... 25 9.7 >BT001734-1|AAN71489.1| 698|Drosophila melanogaster RE71585p protein. Length = 698 Score = 40.3 bits (90), Expect = 3e-04 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Query: 34 MTSTKEYNLVPNDEFDTRIPLHSDEAFDYGIAFQAK 69 M ST Y+LV +D+ D R+PLH+++AF +GI FQAK Sbjct: 1 MPSTP-YDLVQDDQ-DLRVPLHAEQAFFHGITFQAK 34 >AY075524-1|AAL68331.1| 698|Drosophila melanogaster RE71517p protein. Length = 698 Score = 40.3 bits (90), Expect = 3e-04 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Query: 34 MTSTKEYNLVPNDEFDTRIPLHSDEAFDYGIAFQAK 69 M ST Y+LV +D+ D R+PLH+++AF +GI FQAK Sbjct: 1 MPSTP-YDLVQDDQ-DLRVPLHAEQAFFHGITFQAK 34 >AE014296-1687|AAF50246.2| 698|Drosophila melanogaster CG32048-PA, isoform A protein. Length = 698 Score = 40.3 bits (90), Expect = 3e-04 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Query: 34 MTSTKEYNLVPNDEFDTRIPLHSDEAFDYGIAFQAK 69 M ST Y+LV +D+ D R+PLH+++AF +GI FQAK Sbjct: 1 MPSTP-YDLVQDDQ-DLRVPLHAEQAFFHGITFQAK 34 >BT001316-1|AAN71071.1| 690|Drosophila melanogaster AT15050p protein. Length = 690 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 28 LKWRKKMTSTKEYNLVPNDEFDTRIPLH 55 L+W + T E VP+ E TRI LH Sbjct: 217 LRWSTDGSGTYEIEEVPDVELGTRIVLH 244 >AY051535-1|AAK92959.1| 576|Drosophila melanogaster GH18690p protein. Length = 576 Score = 25.4 bits (53), Expect = 9.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Query: 8 TRYVRVILKARTWKRVPMRLLKWRKKMTSTKEY 40 T YV + WKR R L W K T+EY Sbjct: 511 TTYVERKERYGKWKRAVERSLGWVIKQKKTREY 543 >AF115775-1|AAD29307.2| 686|Drosophila melanogaster Hsp90-related protein TRAP1 protein. Length = 686 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 28 LKWRKKMTSTKEYNLVPNDEFDTRIPLH 55 L+W + T E VP+ E TRI LH Sbjct: 212 LRWSTDGSGTYEIEEVPDVELGTRIVLH 239 >AE013599-183|AAF57362.1| 691|Drosophila melanogaster CG3152-PA protein. Length = 691 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 28 LKWRKKMTSTKEYNLVPNDEFDTRIPLH 55 L+W + T E VP+ E TRI LH Sbjct: 217 LRWSTDGSGTYEIEEVPDVELGTRIVLH 244 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.325 0.138 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,359,981 Number of Sequences: 52641 Number of extensions: 107211 Number of successful extensions: 228 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 221 Number of HSP's gapped (non-prelim): 7 length of query: 70 length of database: 24,830,863 effective HSP length: 50 effective length of query: 20 effective length of database: 22,198,813 effective search space: 443976260 effective search space used: 443976260 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -