BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000650-TA|BGIBMGA000650-PA|undefined (70 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78540-6|CAD30431.1| 887|Caenorhabditis elegans Hypothetical pr... 39 4e-04 Z72501-3|CAD30430.1| 887|Caenorhabditis elegans Hypothetical pr... 39 4e-04 U40797-9|AAK95870.1| 349|Caenorhabditis elegans Hypothetical pr... 25 6.5 AF016673-4|AAB66123.1| 684|Caenorhabditis elegans Hypothetical ... 25 6.5 U29382-5|AAG00003.2| 353|Caenorhabditis elegans Hypothetical pr... 25 8.6 >Z78540-6|CAD30431.1| 887|Caenorhabditis elegans Hypothetical protein C33G3.1b protein. Length = 887 Score = 39.1 bits (87), Expect = 4e-04 Identities = 14/30 (46%), Positives = 24/30 (80%) Query: 40 YNLVPNDEFDTRIPLHSDEAFDYGIAFQAK 69 Y+++ +D +D RIPLH++ A+ +GI F+AK Sbjct: 10 YDIIADDVYDCRIPLHNELAYQHGIHFEAK 39 >Z72501-3|CAD30430.1| 887|Caenorhabditis elegans Hypothetical protein C33G3.1b protein. Length = 887 Score = 39.1 bits (87), Expect = 4e-04 Identities = 14/30 (46%), Positives = 24/30 (80%) Query: 40 YNLVPNDEFDTRIPLHSDEAFDYGIAFQAK 69 Y+++ +D +D RIPLH++ A+ +GI F+AK Sbjct: 10 YDIIADDVYDCRIPLHNELAYQHGIHFEAK 39 >U40797-9|AAK95870.1| 349|Caenorhabditis elegans Hypothetical protein C28C12.12 protein. Length = 349 Score = 25.0 bits (52), Expect = 6.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 31 RKKMTSTKEYNLVPNDEFD 49 RKKM Y L+PN+E D Sbjct: 138 RKKMVQELRYELMPNEERD 156 >AF016673-4|AAB66123.1| 684|Caenorhabditis elegans Hypothetical protein T06D4.4 protein. Length = 684 Score = 25.0 bits (52), Expect = 6.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 15 LKARTWKRVPMRLLKWRKKMTSTKEYN 41 LK+ + KR + WRKK+T T+ N Sbjct: 550 LKSESLKRFDNNVKCWRKKITGTRFLN 576 >U29382-5|AAG00003.2| 353|Caenorhabditis elegans Hypothetical protein R03H10.7 protein. Length = 353 Score = 24.6 bits (51), Expect = 8.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 38 KEYNLVPNDEFD 49 K YN+ PNDEF+ Sbjct: 80 KNYNIYPNDEFE 91 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.325 0.138 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,804,114 Number of Sequences: 27539 Number of extensions: 61535 Number of successful extensions: 149 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 144 Number of HSP's gapped (non-prelim): 5 length of query: 70 length of database: 12,573,161 effective HSP length: 50 effective length of query: 20 effective length of database: 11,196,211 effective search space: 223924220 effective search space used: 223924220 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -