BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000650-TA|BGIBMGA000650-PA|undefined (70 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 1.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 20 2.2 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 20 2.2 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 19 6.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 19 6.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 19 6.6 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 1.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 36 STKEYNLVPNDEFDTRIPLHSDEA 59 +TK+ N V DE + I H D+A Sbjct: 906 TTKDPNEVTCDEEEGHISYHPDKA 929 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.2 bits (40), Expect = 2.2 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Query: 13 VILKARTWKRVPMRLLKWRKKMTSTKEYNLV 43 +ILK T+ V +KW + EYNLV Sbjct: 171 LILKENTYDAV----IKWSPNEDYSCEYNLV 197 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 20.2 bits (40), Expect = 2.2 Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 20 WKRVPMRLLKWRKKMTSTKEYNL 42 W RV M L W+ + +++ L Sbjct: 292 WSRVEMALDNWKNDKSLKRKFYL 314 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 18.6 bits (36), Expect = 6.6 Identities = 9/18 (50%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Query: 38 KEYNLVPNDEFDT-RIPL 54 K YN+ N E+DT +PL Sbjct: 57 KIYNIQNNFEYDTASLPL 74 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 18.6 bits (36), Expect = 6.6 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 42 LVPNDEFDTRIP 53 L P++ FD ++P Sbjct: 725 LTPHEAFDVKLP 736 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 18.6 bits (36), Expect = 6.6 Identities = 5/12 (41%), Positives = 9/12 (75%) Query: 42 LVPNDEFDTRIP 53 L P++ FD ++P Sbjct: 617 LTPHEAFDVKLP 628 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.325 0.138 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,148 Number of Sequences: 317 Number of extensions: 498 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 70 length of database: 114,650 effective HSP length: 44 effective length of query: 26 effective length of database: 100,702 effective search space: 2618252 effective search space used: 2618252 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (19.3 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -