BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000647-TA|BGIBMGA000647-PA|IPR002048|Calcium-binding EF-hand, IPR011047|Quinonprotein alcohol dehydrogenase-like (596 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 25 2.0 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 4.5 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 46 LKEVVQALESDPDFRE 61 + +V++ +E+DPDF E Sbjct: 22 ISDVIEVIETDPDFHE 37 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.4 bits (48), Expect = 4.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 67 DEEDVKSGKIAEQLDFVNHNVRTRLDEIKRR 97 DEE K + EQ D + N R ++ ++K+R Sbjct: 66 DEETYKLTPLNEQFDVIKDNYR-KVTDLKKR 95 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.134 0.395 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,288 Number of Sequences: 317 Number of extensions: 3614 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 596 length of database: 114,650 effective HSP length: 61 effective length of query: 535 effective length of database: 95,313 effective search space: 50992455 effective search space used: 50992455 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -