BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000646-TA|BGIBMGA000646-PA|IPR006751|TAFII55 protein conserved region (386 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 3.7 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 8.5 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.0 bits (47), Expect = 3.7 Identities = 12/55 (21%), Positives = 20/55 (36%) Query: 263 NSTNQSLGESLTKSSALPIEFGSHMFQSSQGVSSTSDAKCDLSSEDDGEFSNEKD 317 NS N LG+ P+ M + + D +DD + SN ++ Sbjct: 248 NSINPFLGQGFAVPGLSPLGHTLSMNHKYEKIDKEEHESMDDDDDDDDDMSNSEN 302 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 8.5 Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 245 NVDLQNSRLSVCDSRLSGNSTNQSLGESLTKSSALPIEFGSHMFQSSQGVSST 297 ++D+++ + D L S Q T S+ LP GS++ +S G+ +T Sbjct: 11 SMDIKHEMIYREDDVLLVKSEPQLHSPCATGSNGLPAGAGSNLLCASNGLVTT 63 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.131 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,326 Number of Sequences: 317 Number of extensions: 2638 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 386 length of database: 114,650 effective HSP length: 58 effective length of query: 328 effective length of database: 96,264 effective search space: 31574592 effective search space used: 31574592 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -