BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000646-TA|BGIBMGA000646-PA|IPR006751|TAFII55 protein conserved region (386 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 26 2.0 AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical prote... 25 2.7 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.8 bits (54), Expect = 2.0 Identities = 14/49 (28%), Positives = 22/49 (44%) Query: 225 NIVDIFGGGVSDSDFEDETVNVDLQNSRLSVCDSRLSGNSTNQSLGESL 273 N FGG S ++ E+ T N+D+Q + L+ + L E L Sbjct: 757 NYTSYFGGSPSFTNLENSTRNLDMQELDYNPSKKDLTDAKIHHLLSEEL 805 >AJ297931-1|CAC35451.1| 166|Anopheles gambiae hypothetical protein protein. Length = 166 Score = 25.4 bits (53), Expect = 2.7 Identities = 14/72 (19%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Query: 270 GESLTKSSALPI-EFGSHMFQSSQGVSSTSDAKCDLSSEDDGEFSNEKDDMALRINQLKL 328 G+ L + + P+ E GS + + + + + E+ E +E+ + + + + +L Sbjct: 58 GDELPEDAPEPVPEDGS---PDEEHLEEEQEEEAEADEEEADESESEESEESDELEEARL 114 Query: 329 EVDELKQRRQKI 340 +EL++R+Q++ Sbjct: 115 VAEELEERQQEL 126 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.131 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 335,326 Number of Sequences: 2123 Number of extensions: 12218 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 2 length of query: 386 length of database: 516,269 effective HSP length: 65 effective length of query: 321 effective length of database: 378,274 effective search space: 121425954 effective search space used: 121425954 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -