BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000644-TA|BGIBMGA000644-PA|undefined (93 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 1.2 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 20 4.9 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 19 8.5 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 1.2 Identities = 8/30 (26%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 27 VIDTITFYGWKNVIYVYDSHDEKY--VTQW 54 ++D F W+ + ++ +H+ Y VT W Sbjct: 647 ILDKFFFPRWRQTLAMWLNHNPNYAEVTDW 676 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 19.8 bits (39), Expect = 4.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 6 IPPSSGLIDYAVSMRPDYHRA 26 IP + ++D+ M DYH A Sbjct: 187 IPEINKVVDFINIMSYDYHTA 207 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 19.0 bits (37), Expect = 8.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Query: 44 DSHDEKY 50 D HDEKY Sbjct: 198 DDHDEKY 204 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.136 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,939 Number of Sequences: 317 Number of extensions: 849 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 93 length of database: 114,650 effective HSP length: 48 effective length of query: 45 effective length of database: 99,434 effective search space: 4474530 effective search space used: 4474530 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (20.1 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -