BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000638-TA|BGIBMGA000638-PA|IPR001356|Homeobox, IPR009057|Homeodomain-like, IPR003893|Iroquois-class homeodomain protein (462 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8599| Best HMM Match : No HMM Matches (HMM E-Value=.) 139 4e-33 SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_26157| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_48146| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_25710| Best HMM Match : Homeobox (HMM E-Value=4.8e-17) 48 1e-05 SB_48109| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) 43 6e-04 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) 38 0.017 SB_5629| Best HMM Match : PAX (HMM E-Value=0) 38 0.017 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 38 0.017 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.023 SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) 38 0.023 SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) 37 0.030 SB_58034| Best HMM Match : VWA (HMM E-Value=0) 36 0.052 SB_37814| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_37035| Best HMM Match : Homeobox (HMM E-Value=9.6e-09) 36 0.069 SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) 35 0.12 SB_47470| Best HMM Match : Pou (HMM E-Value=1.3e-22) 35 0.12 SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) 35 0.12 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 34 0.21 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 34 0.21 SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) 34 0.28 SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) 33 0.48 SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) 33 0.48 SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) 33 0.64 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.64 SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) 33 0.64 SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.64 SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) 33 0.64 SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 32 0.85 SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) 32 0.85 SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_23988| Best HMM Match : F5_F8_type_C (HMM E-Value=5e-10) 32 1.1 SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) 32 1.1 SB_19758| Best HMM Match : Homeobox (HMM E-Value=1.6e-20) 32 1.1 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.1 SB_2610| Best HMM Match : F5_F8_type_C (HMM E-Value=4.5e-29) 31 1.5 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 2.0 SB_28281| Best HMM Match : Pou (HMM E-Value=0) 31 2.6 SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) 31 2.6 SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) 30 3.4 SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) 30 3.4 SB_44298| Best HMM Match : Herpes_US9 (HMM E-Value=8.9) 30 3.4 SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) 30 4.5 SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) 30 4.5 SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.5 SB_32283| Best HMM Match : Homeobox (HMM E-Value=4.5e-20) 30 4.5 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 30 4.5 SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.5 SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) 30 4.5 SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) 30 4.5 SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.5 SB_15581| Best HMM Match : F5_F8_type_C (HMM E-Value=3.7e-11) 30 4.5 SB_2217| Best HMM Match : LIM (HMM E-Value=1.2e-40) 30 4.5 SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) 29 6.0 SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) 29 6.0 SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) 29 7.9 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_37787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_11862| Best HMM Match : Homeobox (HMM E-Value=1.1e-16) 29 7.9 >SB_8599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 139 bits (337), Expect = 4e-33 Identities = 62/70 (88%), Positives = 67/70 (95%) Query: 14 ARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 ARRKNATRE+T TLKAWL EH+KNPYPTKGEKIMLAI+TKMTLTQVSTWFANARRRLKKE Sbjct: 156 ARRKNATRETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRLKKE 215 Query: 74 NKMTWEPKNK 83 NKMTW P+N+ Sbjct: 216 NKMTWSPRNR 225 >SB_40626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 60.1 bits (139), Expect = 4e-09 Identities = 25/61 (40%), Positives = 41/61 (67%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 ++ +E+T L++WLN++ + PYP K L +T+++ TQV+TWFANARRRL + Sbjct: 138 QKSTLPKEATRILQSWLNDNLEKPYPDAETKERLQQLTQLSKTQVNTWFANARRRLNRNR 197 Query: 75 K 75 + Sbjct: 198 Q 198 >SB_26157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1097 Score = 58.0 bits (134), Expect = 1e-08 Identities = 24/57 (42%), Positives = 38/57 (66%) Query: 14 ARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 70 ++R +++T +K WL +H +PYPT+ EK +A T +T+ QV+ WF NARRR+ Sbjct: 950 SKRGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRI 1006 >SB_48146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 55.2 bits (127), Expect = 1e-07 Identities = 23/50 (46%), Positives = 35/50 (70%) Query: 21 RESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 70 + +T +KAWL +H +PYP++ +K LA T +T+ QV+ WF NARRR+ Sbjct: 305 KAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRI 354 >SB_25710| Best HMM Match : Homeobox (HMM E-Value=4.8e-17) Length = 108 Score = 48.4 bits (110), Expect = 1e-05 Identities = 21/58 (36%), Positives = 34/58 (58%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 72 +R+N ++++T L + H NPYP++ K LA +++ Q+S WF N R R KK Sbjct: 3 KRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIRYKK 60 >SB_48109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/35 (54%), Positives = 26/35 (74%) Query: 37 NPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 71 +PYPT EK LA +T +T+TQVS WF N R+R++ Sbjct: 201 SPYPTPREKHELAKMTDLTVTQVSNWFKNKRQRVR 235 >SB_22870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.4 bits (100), Expect = 2e-04 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 RR+ T S TLK L H+ N Y T+ + LA +T TQV WF N R + K+ Sbjct: 117 RRQRTTFTSEQTLKLELEFHQ-NEYITRSRRFELAACLNLTETQVKIWFQNRRAKDKRLE 175 Query: 75 KMTWEPKNKAXXXXXTM 91 K E + + TM Sbjct: 176 KAQMEQQLRLASYTNTM 192 >SB_34953| Best HMM Match : Homeobox (HMM E-Value=1e-25) Length = 200 Score = 42.7 bits (96), Expect = 6e-04 Identities = 22/63 (34%), Positives = 36/63 (57%) Query: 12 LAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 71 LA +R+ T ++ LK ++ K + Y T E+ M+A ++T Q+ TWF N R + K Sbjct: 93 LAKKRRKRTAFTSFQLKCLEDKFKFSKYLTIAERDMMARSLQLTNRQIKTWFQNRRTKWK 152 Query: 72 KEN 74 +EN Sbjct: 153 REN 155 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/36 (50%), Positives = 25/36 (69%) Query: 34 HKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 69 +++N YPT EK ++A T +TL QVS WF N R+R Sbjct: 153 YEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKNRRQR 188 >SB_32587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/60 (38%), Positives = 30/60 (50%) Query: 17 KNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKM 76 KN T ST L E N Y + +I +A ++T QV WF N R + KKENK+ Sbjct: 70 KNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQNRRMKWKKENKL 129 >SB_48629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 38.3 bits (85), Expect = 0.013 Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 72 +RK T +T L+ NE +N Y T+ + +A+ +T QV WF N R + K+ Sbjct: 145 KRKERTAFTTHQLRELENEFTRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKR 202 >SB_42639| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 225 Score = 37.9 bits (84), Expect = 0.017 Identities = 20/58 (34%), Positives = 31/58 (53%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 R+ T ++ LK+ + ++ Y T E+ LA +T TQV TWF N R + KK+ Sbjct: 100 RRRRTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWFQNRRTKWKKQ 157 >SB_5629| Best HMM Match : PAX (HMM E-Value=0) Length = 383 Score = 37.9 bits (84), Expect = 0.017 Identities = 20/64 (31%), Positives = 33/64 (51%) Query: 12 LAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 71 L R+ TR ++ L +E +NPYPT E+ LA + ++V WF+N R + K Sbjct: 274 LLLTRRTRTRFTSQQLHVLQSEFTRNPYPTLEERKELARYLCVCESRVQVWFSNKRAQDK 333 Query: 72 KENK 75 + + Sbjct: 334 RRTR 337 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 37.9 bits (84), Expect = 0.017 Identities = 20/58 (34%), Positives = 31/58 (53%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 R+ T ++ LK+ + ++ Y T E+ LA +T TQV TWF N R + KK+ Sbjct: 939 RRRRTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWFQNRRTKWKKQ 996 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 37.5 bits (83), Expect = 0.023 Identities = 21/66 (31%), Positives = 31/66 (46%) Query: 7 GAGYDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA 66 G G +RK T S L+ NE +N Y T+ + +A+ +T QV WF N Sbjct: 134 GDGGKTTRKRKERTAFSKHQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKVWFQNR 193 Query: 67 RRRLKK 72 R + K+ Sbjct: 194 RMKWKR 199 >SB_36278| Best HMM Match : Homeobox (HMM E-Value=4.8e-30) Length = 166 Score = 37.5 bits (83), Expect = 0.023 Identities = 21/59 (35%), Positives = 31/59 (52%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 R+ T + L A N+ K Y + E++ LA+ +T TQV WF N R + KK+N Sbjct: 49 RRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLGLTETQVKIWFQNRRTKWKKQN 107 >SB_20497| Best HMM Match : Homeobox (HMM E-Value=1.4013e-45) Length = 527 Score = 37.1 bits (82), Expect = 0.030 Identities = 18/62 (29%), Positives = 32/62 (51%) Query: 11 DLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 70 +L +RK T + ++ NE ++N Y T+ + +A+ +T QV WF N R + Sbjct: 88 NLGKKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKW 147 Query: 71 KK 72 K+ Sbjct: 148 KR 149 >SB_58034| Best HMM Match : VWA (HMM E-Value=0) Length = 1203 Score = 36.3 bits (80), Expect = 0.052 Identities = 18/50 (36%), Positives = 28/50 (56%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKN 82 E ++ Y T+ ++ L+ +MT TQV TWF N R + +KE + P N Sbjct: 1034 EFEEKRYLTETKRAELSKDLEMTETQVKTWFQNRRTKWRKEKMLRVIPDN 1083 Score = 35.5 bits (78), Expect = 0.091 Identities = 18/50 (36%), Positives = 25/50 (50%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPKN 82 E N Y T+ ++ L+ MT TQV TWF N R + +K+ P N Sbjct: 1133 EFSGNKYLTESKREQLSKDLGMTETQVKTWFQNRRTKWRKKKMQRMLPDN 1182 >SB_37814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 36.3 bits (80), Expect = 0.052 Identities = 18/43 (41%), Positives = 25/43 (58%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 E K+ Y T+ ++ L+ MT TQV TWF N R + +KE K Sbjct: 219 EFKEEKYLTESKRAELSKDLGMTETQVKTWFQNRRTKWRKELK 261 >SB_37035| Best HMM Match : Homeobox (HMM E-Value=9.6e-09) Length = 243 Score = 35.9 bits (79), Expect = 0.069 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Query: 27 LKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 69 L+ W + ++PYP +K LA T +T TQV WF N R+R Sbjct: 144 LREW---YLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQR 183 >SB_39723| Best HMM Match : Homeobox (HMM E-Value=5.4e-32) Length = 257 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/60 (33%), Positives = 31/60 (51%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 R+ T S+ L A + + + Y T+ ++ LA +T TQV WF N R + K+ NK Sbjct: 107 RRPRTAFSSHQLLALERQFQLHKYLTRPQRYELATSLMLTETQVKIWFQNRRMKWKRCNK 166 >SB_47470| Best HMM Match : Pou (HMM E-Value=1.3e-22) Length = 441 Score = 35.1 bits (77), Expect = 0.12 Identities = 17/64 (26%), Positives = 30/64 (46%) Query: 9 GYDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 68 G + +RK T S L+ ++ ++NP P+ E +A + V WF N ++ Sbjct: 228 GLRVCKKRKRRTSFSNEALRLLISHFEQNPKPSSSEIAQIASKLGLEPVTVRVWFCNRKQ 287 Query: 69 RLKK 72 LK+ Sbjct: 288 MLKR 291 >SB_24287| Best HMM Match : Homeobox (HMM E-Value=9e-28) Length = 561 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/64 (31%), Positives = 32/64 (50%) Query: 10 YDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 69 Y + R+ T ++ LK + ++ Y T E+ LA ++ TQV TWF N R + Sbjct: 428 YHSSKSRRKRTAFTSSQLKYLEEKFQEKKYLTISERNELAKSMYLSDTQVKTWFQNRRTK 487 Query: 70 LKKE 73 KK+ Sbjct: 488 WKKQ 491 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 34.3 bits (75), Expect = 0.21 Identities = 16/40 (40%), Positives = 23/40 (57%) Query: 35 KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 ++ Y + E+ LA I +T TQV WF N R + KK+N Sbjct: 112 RQQRYLSAPEREQLARIINLTPTQVKIWFQNHRYKFKKQN 151 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 34.3 bits (75), Expect = 0.21 Identities = 18/66 (27%), Positives = 30/66 (45%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 +R+N T + L+ +K YP + LA+ +T +V WF N R + +K Sbjct: 404 KRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRE 463 Query: 75 KMTWEP 80 + T P Sbjct: 464 RFTQVP 469 >SB_18749| Best HMM Match : Homeobox (HMM E-Value=6.1e-28) Length = 222 Score = 33.9 bits (74), Expect = 0.28 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 1/69 (1%) Query: 15 RRKNATRESTGTLKAWLNEH-KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 ++K A TG L + + Y T E+ +A + +T TQV WF N R + KK+ Sbjct: 108 KKKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKIWFQNRRTKWKKQ 167 Query: 74 NKMTWEPKN 82 K E N Sbjct: 168 EKEINEDAN 176 >SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2103 Score = 33.5 bits (73), Expect = 0.37 Identities = 17/69 (24%), Positives = 33/69 (47%) Query: 12 LAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK 71 L RR++ T + L+ + N YP + LA+ + +++ WF N R +++ Sbjct: 317 LPKRRRSRTNFDSWQLEELEKIYHHNQYPDVFTREALALKLDLLESRIQVWFQNRRAKMR 376 Query: 72 KENKMTWEP 80 +E K+ P Sbjct: 377 REEKVKAVP 385 >SB_23338| Best HMM Match : Homeobox (HMM E-Value=3.1e-26) Length = 275 Score = 33.1 bits (72), Expect = 0.48 Identities = 19/63 (30%), Positives = 29/63 (46%) Query: 11 DLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 70 D+A +KN + S + + Y E+ LA+ MT QV TWF N R + Sbjct: 94 DIAVPKKNRSSFSAEQVFRLEKTFELQQYLGTKERQQLALALNMTDNQVKTWFQNRRMKQ 153 Query: 71 KKE 73 K++ Sbjct: 154 KRK 156 >SB_8774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 33.1 bits (72), Expect = 0.48 Identities = 15/37 (40%), Positives = 21/37 (56%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 Y TK + +A + +T QV WF N R + KK+NK Sbjct: 172 YLTKERRTEMARMLDLTERQVKIWFQNRRMKWKKDNK 208 >SB_3037| Best HMM Match : Homeobox (HMM E-Value=4.3e-27) Length = 308 Score = 33.1 bits (72), Expect = 0.48 Identities = 21/62 (33%), Positives = 28/62 (45%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 RK T S+ L+ K Y E+ LA +T TQV WF N R + KK K Sbjct: 175 RKPRTIYSSFQLRELNKRFIKTQYLALPERADLAAYLGLTQTQVKIWFQNRRSKFKKTLK 234 Query: 76 MT 77 ++ Sbjct: 235 VS 236 >SB_16449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 33.1 bits (72), Expect = 0.48 Identities = 18/61 (29%), Positives = 29/61 (47%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 R+N T +T L +K+ YP + LA+ + +V WF N R + ++E K Sbjct: 86 RRNRTTFTTFQLHELERAFEKSHYPDVYTREELALKISLPEVRVQVWFQNKRAKWRREEK 145 Query: 76 M 76 M Sbjct: 146 M 146 >SB_22129| Best HMM Match : Homeobox (HMM E-Value=4.6e-26) Length = 366 Score = 32.7 bits (71), Expect = 0.64 Identities = 15/39 (38%), Positives = 22/39 (56%) Query: 35 KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 ++ Y + E+ LA I +T TQV WF N R + KK+ Sbjct: 244 RQQKYLSANEREQLARIIDLTPTQVKIWFQNHRYKFKKQ 282 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 32.7 bits (71), Expect = 0.64 Identities = 16/61 (26%), Positives = 30/61 (49%) Query: 15 RRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 +R+ T ++ L+ +N YP + +A+ T +T +V WF N R + +K+ Sbjct: 741 QRRQRTHFTSFQLQQLEGTFGRNRYPDMQMREEIALYTNLTEARVRVWFKNRRAKWRKKE 800 Query: 75 K 75 K Sbjct: 801 K 801 >SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) Length = 197 Score = 32.7 bits (71), Expect = 0.64 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 32 NEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK---ENKMTWEPKNKA 84 N +KN Y E+ LA ++ TQ+ WF N R + K+ E K T + N + Sbjct: 108 NAFEKNHYIVGTERKQLASYLNLSETQIKVWFQNRRTKWKRQQAEEKATQQAANNS 163 >SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 32.7 bits (71), Expect = 0.64 Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 36 KNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 KN Y E+ LA K++ TQV WF N R + K++ Sbjct: 153 KNHYVVGTERKQLASYLKLSETQVKVWFQNRRTKWKRQ 190 >SB_4115| Best HMM Match : Homeobox (HMM E-Value=9.4e-08) Length = 267 Score = 32.7 bits (71), Expect = 0.64 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 31 LNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR-LKKENKM 76 L E++ N +P K ++ LA + ++ TWFAN R R + NK+ Sbjct: 68 LQEYESNIHPNKEQRTRLAQELRTKEKRIRTWFANKRARDRRNRNKL 114 >SB_30811| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 133 Score = 32.3 bits (70), Expect = 0.85 Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 Y T+ +I +A K+T Q+ WF N R + K+E K Sbjct: 46 YLTRTRRIEIATTLKLTEMQIKIWFQNRRMKWKREFK 82 >SB_10407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 32.3 bits (70), Expect = 0.85 Identities = 17/43 (39%), Positives = 21/43 (48%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 E N Y + LA K+T QV WF N R +LKK+ K Sbjct: 117 EFHYNKYLCGTRRRELANAMKLTERQVKVWFQNRRMKLKKDEK 159 >SB_53178| Best HMM Match : Homeobox (HMM E-Value=2.5e-26) Length = 428 Score = 32.3 bits (70), Expect = 0.85 Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 Y T+ +I +A K+T Q+ WF N R + K+E K Sbjct: 273 YLTRTRRIEIATTLKLTEMQIKIWFQNRRMKWKREFK 309 >SB_29192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 32.3 bits (70), Expect = 0.85 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 E +N Y ++ +I +A + ++ QV WF N R + KK+ K Sbjct: 319 EFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRVKWKKDKK 361 >SB_23988| Best HMM Match : F5_F8_type_C (HMM E-Value=5e-10) Length = 304 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/45 (37%), Positives = 20/45 (44%) Query: 405 SVANPLGSGGGSGYCFPRHQQSPQRDPYHNPHHAPTNHQPNQPHH 449 S +PLG G S P HNPHHA N+QP + H Sbjct: 98 SKPHPLGMEDGRIQDTSITASSTYSSPGHNPHHARLNNQPVKEKH 142 >SB_596| Best HMM Match : Homeobox (HMM E-Value=4.5e-32) Length = 162 Score = 31.9 bits (69), Expect = 1.1 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Query: 9 GYDLAARRKNA-TRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANAR 67 G D R + A T E L+A E +K+ Y + ++ LA +T TQ+ WF N R Sbjct: 22 GDDTKKRPRTAFTNEQIKDLEA---EFQKSKYLSVSRRMELANSLSLTETQIKIWFQNRR 78 Query: 68 RRLKKE 73 + K++ Sbjct: 79 TKWKRK 84 >SB_19758| Best HMM Match : Homeobox (HMM E-Value=1.6e-20) Length = 228 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 Y +K + LA +T QV TWF N R R +KE + Sbjct: 144 YISKSRRSALAAEIDLTDAQVRTWFQNRRTRWRKEER 180 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 31.9 bits (69), Expect = 1.1 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Query: 9 GYDLAARRKNATRESTGT---LKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFAN 65 G D A+RK +T T L+ K YP + LA+ +T +V WF N Sbjct: 277 GKDSTAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQN 336 Query: 66 ARRRLKKENK 75 R + +K K Sbjct: 337 RRAKWRKREK 346 >SB_2610| Best HMM Match : F5_F8_type_C (HMM E-Value=4.5e-29) Length = 334 Score = 31.5 bits (68), Expect = 1.5 Identities = 17/42 (40%), Positives = 20/42 (47%) Query: 408 NPLGSGGGSGYCFPRHQQSPQRDPYHNPHHAPTNHQPNQPHH 449 +PLG GS S +P HNPHHA N+QP H Sbjct: 151 HPLGMEDGSIQNTSITASSHWIEPGHNPHHARLNNQPVGGQH 192 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 31.5 bits (68), Expect = 1.5 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 10 YDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 69 Y+L ++K T + + + Y E+ LA +T TQV TWF N R + Sbjct: 398 YELL-KKKPRTAFTESQISELEKRFQSQKYLGSKERSELAGTLGLTDTQVKTWFQNRRMK 456 Query: 70 LKKENK 75 LK++ + Sbjct: 457 LKRQRQ 462 >SB_8775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 31.5 bits (68), Expect = 1.5 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Query: 3 LKRYGAGYDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTW 62 LK + + A R T + K +L +H Y ++ +I + + ++ QV TW Sbjct: 35 LKTSSSTSNHAPRSAFTTVQQLEIEKEFLYDH----YVSRVRRIEIVMALDLSEKQVRTW 90 Query: 63 FANARRRLKKENK 75 F N R +LK+E K Sbjct: 91 FQNRRMKLKREAK 103 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 31.1 bits (67), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Query: 421 PRHQQSPQRDPYHNPHHAPTNHQPNQPH 448 P QQS Q+ P H P QPNQ H Sbjct: 250 PGQQQSNQQQPPQQQQHGPGQMQPNQQH 277 >SB_28281| Best HMM Match : Pou (HMM E-Value=0) Length = 250 Score = 30.7 bits (66), Expect = 2.6 Identities = 18/66 (27%), Positives = 27/66 (40%) Query: 7 GAGYDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA 66 G + RRK T +A N K P+ E + +A ++ V WF N Sbjct: 169 GEKFGAERRRKRRTTIGLAAKEALENHFMKQTKPSSPEIVRIADGLRLDKEVVRVWFCNR 228 Query: 67 RRRLKK 72 R+R K+ Sbjct: 229 RQREKR 234 >SB_26105| Best HMM Match : Homeobox (HMM E-Value=1.1e-30) Length = 315 Score = 30.7 bits (66), Expect = 2.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 E ++ Y E+ LA +T TQV WF N R + +K+ Sbjct: 266 EFERQQYMVGAERHYLAASLNLTETQVKVWFQNRRIKWRKQ 306 >SB_57651| Best HMM Match : Homeobox (HMM E-Value=3e-29) Length = 294 Score = 30.3 bits (65), Expect = 3.4 Identities = 18/59 (30%), Positives = 26/59 (44%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 RK+ T + L+ + Y + LA I + QV TWF N R + KK+N Sbjct: 169 RKSRTVFTDLQLRVLEKTFSEQKYLDSTNRAKLAQILGLNEAQVKTWFQNRRMKWKKKN 227 >SB_15| Best HMM Match : Homeobox (HMM E-Value=4.1e-30) Length = 287 Score = 30.3 bits (65), Expect = 3.4 Identities = 15/42 (35%), Positives = 20/42 (47%) Query: 33 EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 E Y E+ LA +T TQV WF N R + +K+N Sbjct: 229 EFDNQQYIVGTERFYLATELGLTETQVKVWFQNRRIKWRKQN 270 >SB_44298| Best HMM Match : Herpes_US9 (HMM E-Value=8.9) Length = 138 Score = 30.3 bits (65), Expect = 3.4 Identities = 11/28 (39%), Positives = 14/28 (50%) Query: 423 HQQSPQRDPYHNPHHAPTNHQPNQPHHN 450 H+ R YH+ HH NH + HHN Sbjct: 36 HKLKNPRHRYHHHHHHQHNHHQHHHHHN 63 >SB_11435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.3 bits (65), Expect = 3.4 Identities = 18/59 (30%), Positives = 26/59 (44%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 RK+ T + L+ + Y + LA + TQV TWF N R + KKE+ Sbjct: 511 RKSRTVFTDLQLRVLEKTFSEQKYLDTSSRAKLAQTLGLNETQVKTWFQNRRMKWKKES 569 >SB_53611| Best HMM Match : Homeobox (HMM E-Value=1.2e-25) Length = 389 Score = 29.9 bits (64), Expect = 4.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT 77 Y TK ++ LA + +T QV WF N R + +++ + T Sbjct: 338 YLTKADRHQLASMLGLTDNQVKVWFQNRRMKWRQDARET 376 >SB_49275| Best HMM Match : Homeobox (HMM E-Value=2.8e-27) Length = 116 Score = 29.9 bits (64), Expect = 4.5 Identities = 15/43 (34%), Positives = 20/43 (46%) Query: 35 KKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT 77 ++ Y E+ LA +T TQV WF N R R +K T Sbjct: 70 ERQQYVAGEERRQLATGLNLTETQVKVWFQNRRIRFRKHRLKT 112 >SB_39292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.9 bits (64), Expect = 4.5 Identities = 17/58 (29%), Positives = 27/58 (46%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 R++ TR + +K YP + LA ++ +V WF+N R RL+KE Sbjct: 549 RRSRTRFTVSQTDELERAFRKTHYPDIYAREELAQRLGLSEARVQVWFSNRRARLRKE 606 >SB_32283| Best HMM Match : Homeobox (HMM E-Value=4.5e-20) Length = 398 Score = 29.9 bits (64), Expect = 4.5 Identities = 14/37 (37%), Positives = 20/37 (54%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK 75 Y E+ LA MT QV TWF N R ++K++ + Sbjct: 264 YVCSSERQKLAKELNMTDQQVKTWFQNRRMKVKRKRQ 300 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.9 bits (64), Expect = 4.5 Identities = 23/90 (25%), Positives = 33/90 (36%), Gaps = 3/90 (3%) Query: 256 ARGRGVAPQSDEERKGDEMLQGMHHQLLSYGIKEESKRTSDCGVPIPASKPKIWSLADTA 315 AR AP S E K + ++ + + Y +K E T+ + K A Sbjct: 601 ARSSNAAPGSGELEKLRKEIEKLKEE---YALKTEEYNTTISELRRDLEKASTKEAATPE 657 Query: 316 ACKTPPPAAQPWPQHSYGPPERAAPIDGSS 345 A PPP P Q PP P+ G + Sbjct: 658 AGPPPPPPPPPGGQAGGAPPPPPPPLPGGA 687 >SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.9 bits (64), Expect = 4.5 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Query: 11 DLAARRKNATRESTGTLKAWLNEHK--KNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 68 D RRK TR + + E Y + E+ LA +T TQV WF N R Sbjct: 207 DSKKRRKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKIWFQNRRN 266 Query: 69 RLKKE 73 + K++ Sbjct: 267 KWKRQ 271 >SB_41873| Best HMM Match : Homeobox (HMM E-Value=2.3e-29) Length = 651 Score = 29.9 bits (64), Expect = 4.5 Identities = 17/69 (24%), Positives = 31/69 (44%) Query: 8 AGYDLAARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANAR 67 +G + R++ T S LK + N Y E+ +A ++ QV WF N R Sbjct: 537 SGSYVQKRKRARTAFSAEQLKKLEKRFQANHYIVGEERQKIAKDLDLSEAQVKVWFQNRR 596 Query: 68 RRLKKENKM 76 + K++ ++ Sbjct: 597 TKFKRDQEL 605 >SB_25357| Best HMM Match : Homeobox (HMM E-Value=8.3e-28) Length = 317 Score = 29.9 bits (64), Expect = 4.5 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Query: 34 HKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 72 H+K Y + E+ LA K+T TQV WF N R + K+ Sbjct: 151 HQK--YLSGPERADLAAALKLTETQVKIWFQNRRYKTKR 187 >SB_25008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 29.9 bits (64), Expect = 4.5 Identities = 17/62 (27%), Positives = 29/62 (46%) Query: 14 ARRKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 A + T + LK + Y ++ E+ +LA +MT QV WF N R + K++ Sbjct: 152 ANPRTRTHFTERQLKYLETYYSNGRYLSRDERTVLAQALEMTELQVRNWFQNRRYQRKQK 211 Query: 74 NK 75 + Sbjct: 212 QE 213 >SB_15581| Best HMM Match : F5_F8_type_C (HMM E-Value=3.7e-11) Length = 133 Score = 29.9 bits (64), Expect = 4.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 430 DPYHNPHHAPTNHQPNQPHH 449 +P HNPHHA N+QP H Sbjct: 19 EPGHNPHHARLNNQPVGGQH 38 >SB_2217| Best HMM Match : LIM (HMM E-Value=1.2e-40) Length = 434 Score = 29.9 bits (64), Expect = 4.5 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 8/80 (10%) Query: 6 YGAGYDLAARRKNATRESTGTLKAWLNEHKKN-----PYPTKGEKIMLAIITKMTLTQVS 60 YG DL A + R T+KA E K+ P P++ + LA T + + + Sbjct: 139 YGLDEDLDAALASKRRGPRTTIKAKQLEALKSTFAATPKPSRNIREKLAQETGLNMRVIQ 198 Query: 61 TWFANAR---RRLKKENKMT 77 WF N R RRLK+ T Sbjct: 199 VWFQNRRSKERRLKQSGGQT 218 >SB_57648| Best HMM Match : Homeobox (HMM E-Value=5.3e-30) Length = 205 Score = 29.5 bits (63), Expect = 6.0 Identities = 18/58 (31%), Positives = 25/58 (43%) Query: 16 RKNATRESTGTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 73 RK+ T + L+ + Y + LA + TQV TWF N R + KKE Sbjct: 121 RKSRTVFTDLQLRVLEKTFSEQKYLDTSSRSKLAQTLGLNETQVKTWFQNRRMKWKKE 178 >SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) Length = 1105 Score = 29.5 bits (63), Expect = 6.0 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Query: 33 EHKKNPYPTKGEKIMLAIITKMT--LTQVSTWFANARRRLKKENKMTWEP 80 + ++P K + L + T M + +ST A+ R LK+EN TW+P Sbjct: 540 QQMQSPTNRKELQTFLGLATYMDRFIPNLSTLTASLRELLKEENHFTWDP 589 >SB_58702| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.059) Length = 765 Score = 29.1 bits (62), Expect = 7.9 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 302 PASKPKIWSL-ADTAACKTPP-PAAQPWPQHSYGPPERAAPIDGS 344 PA +P + + ++ TPP P + P+P Y PP AP+ G+ Sbjct: 449 PAPQPTMQTTPTHSSTSHTPPTPISAPYPVEGYPPPLIYAPMSGA 493 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 29.1 bits (62), Expect = 7.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 421 PRHQQSPQRDPYHNPHHAPTNHQPNQP 447 PR + + RD Y N HH + QP+ P Sbjct: 547 PRDRDNNARDRYENRHHGSRDRQPSFP 573 >SB_37787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 7.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 36 KNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 72 + PY + E+ LA +T QV WF N R + K+ Sbjct: 40 EKPYLSYTERDQLARAVNLTAKQVKVWFQNKRYKTKE 76 >SB_21452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 29.1 bits (62), Expect = 7.9 Identities = 13/41 (31%), Positives = 20/41 (48%) Query: 36 KNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKM 76 K PYP + LA +T ++ WF N R + +K K+ Sbjct: 84 KAPYPDVFAREELAAKLGLTEARIQVWFQNRRAKWRKREKL 124 >SB_11862| Best HMM Match : Homeobox (HMM E-Value=1.1e-16) Length = 99 Score = 29.1 bits (62), Expect = 7.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 39 YPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 74 Y + LA I + QV TWF N R + KK+N Sbjct: 13 YLDSTNRAKLAQILGLNEAQVKTWFQNRRMKWKKKN 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.134 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,870,396 Number of Sequences: 59808 Number of extensions: 587452 Number of successful extensions: 1691 Number of sequences better than 10.0: 72 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 1609 Number of HSP's gapped (non-prelim): 88 length of query: 462 length of database: 16,821,457 effective HSP length: 85 effective length of query: 377 effective length of database: 11,737,777 effective search space: 4425141929 effective search space used: 4425141929 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -