BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000637-TA|BGIBMGA000637-PA|undefined (187 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 1.4 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 5.6 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.4 bits (48), Expect = 1.4 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Query: 98 GVYGTPYPSTDQNPYPSIGVDSSAFYSPLVPTDRLPFARIEGKVYRSRY 146 GV +P S Q P G S+ SPL P R F R G+ +RY Sbjct: 234 GVVTSPL-SQQQQAAPQ-GAASANLPSPLYPWMRSQFERKRGRQTYTRY 280 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 147 NEFGYSGVACEPESNRSW 164 +E GY + E NRSW Sbjct: 211 DELGYGLIVYSWEQNRSW 228 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.318 0.133 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,667 Number of Sequences: 429 Number of extensions: 1850 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 187 length of database: 140,377 effective HSP length: 54 effective length of query: 133 effective length of database: 117,211 effective search space: 15589063 effective search space used: 15589063 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -