BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000637-TA|BGIBMGA000637-PA|undefined (187 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical pr... 29 1.6 AF025453-5|AAY55851.1| 279|Caenorhabditis elegans Hypothetical ... 27 8.3 >U80846-3|AAC70890.1| 2232|Caenorhabditis elegans Hypothetical protein K06A9.1b protein. Length = 2232 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 59 DTPRPIITDPVSGQTVCSCQYDGARLALTSYPRLSSAAVGVYGTPYPSTDQNPYPSIGVD 118 ++P +T P TV G+ + + S +S + +P PST QNP PS Sbjct: 806 NSPGSTVTRP---STVSGSTSSGSTVTVGSTEASTSGSSVASSSPAPSTSQNPNPSTSSG 862 Query: 119 SS 120 SS Sbjct: 863 SS 864 >AF025453-5|AAY55851.1| 279|Caenorhabditis elegans Hypothetical protein C08F1.11 protein. Length = 279 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 119 SSAFYSPLVPTDRLPFARIEGKVYRSRYNEFGYSGVACEPESNRSW 164 ++ ++ P++ +P + Y S EF +SGV EP S + W Sbjct: 212 TTRYFCPIINILAIPIVYVAFLAYNSDEFEFEFSGV--EPTSGKFW 255 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.318 0.133 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,921,756 Number of Sequences: 27539 Number of extensions: 162867 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 388 Number of HSP's gapped (non-prelim): 5 length of query: 187 length of database: 12,573,161 effective HSP length: 77 effective length of query: 110 effective length of database: 10,452,658 effective search space: 1149792380 effective search space used: 1149792380 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -