BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000635-TA|BGIBMGA000635-PA|IPR001766|Fork head transcription factor (178 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38328| Best HMM Match : No HMM Matches (HMM E-Value=.) 168 2e-42 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) 131 4e-31 SB_32062| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 8e-31 SB_34638| Best HMM Match : Fork_head (HMM E-Value=0) 129 1e-30 SB_47058| Best HMM Match : Fork_head (HMM E-Value=0) 129 1e-30 SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 3e-30 SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) 123 7e-29 SB_12905| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 7e-25 SB_5069| Best HMM Match : Fork_head (HMM E-Value=0) 108 2e-24 SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) 108 3e-24 SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) 108 3e-24 SB_53442| Best HMM Match : Fork_head (HMM E-Value=0) 103 1e-22 SB_10139| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) 95 4e-20 SB_15500| Best HMM Match : Fork_head (HMM E-Value=1.7e-39) 94 5e-20 SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 4e-19 SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 5e-19 SB_17376| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 8e-18 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 84 5e-17 SB_51547| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) 75 3e-14 SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) 62 3e-10 SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 1e-08 SB_5489| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_40026| Best HMM Match : Fork_head (HMM E-Value=4.2e-05) 45 4e-05 SB_51004| Best HMM Match : Fork_head (HMM E-Value=3) 42 3e-04 SB_38984| Best HMM Match : Fork_head (HMM E-Value=3e-06) 38 0.005 SB_58766| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_28299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) 27 8.7 SB_19778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_46521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_38328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 168 bits (409), Expect = 2e-42 Identities = 74/104 (71%), Positives = 84/104 (80%) Query: 11 IKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQ 70 IKA+ ++ KPPYSYVALI MAI+ S KR TL+ IY YI +FP++EKNKKGWQ Sbjct: 30 IKAEGKDTSKDPNVKPPYSYVALIAMAIRESPEKRLTLNGIYQYIISKFPYYEKNKKGWQ 89 Query: 71 NSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 NSIRHNLSLNECFIKVPREGGGERKGNYWTLDP C +MFE GN+ Sbjct: 90 NSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY 133 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 134 bits (323), Expect = 5e-32 Identities = 57/94 (60%), Positives = 72/94 (76%) Query: 21 QALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLN 80 Q + KPPYSY+ALI MAIQ++ KR TLS IY++I FP++ NK+GWQNSIRHNLSLN Sbjct: 54 QDMVKPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLN 113 Query: 81 ECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 ECF+KVPR+ KG++W LDP MFENG++ Sbjct: 114 ECFVKVPRDDKKPGKGSFWMLDPDSLNMFENGSY 147 >SB_13048| Best HMM Match : Fork_head (HMM E-Value=0) Length = 311 Score = 131 bits (316), Expect = 4e-31 Identities = 56/93 (60%), Positives = 71/93 (76%) Query: 22 ALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNE 81 AL+KPPYSY+ALITMAI S ++ TLS+I +I + FP++ + WQNSIRHNLSLN+ Sbjct: 61 ALSKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLND 120 Query: 82 CFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 CF+K+PRE G KGNYWTLDP MF+NG+F Sbjct: 121 CFVKMPREPGNPGKGNYWTLDPASEGMFDNGSF 153 >SB_32062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 130 bits (313), Expect = 8e-31 Identities = 55/88 (62%), Positives = 67/88 (76%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KPPYSY++LITMAIQ S K TLSEIY +I FP++ +N++ WQNSIRH+LS N+CF+ Sbjct: 39 KPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFV 98 Query: 85 KVPREGGGERKGNYWTLDPQCGEMFENG 112 KVPR KG+YWTL P CG MFENG Sbjct: 99 KVPRSPDRPGKGSYWTLHPDCGNMFENG 126 >SB_34638| Best HMM Match : Fork_head (HMM E-Value=0) Length = 312 Score = 129 bits (312), Expect = 1e-30 Identities = 56/91 (61%), Positives = 71/91 (78%), Gaps = 1/91 (1%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KPP+SY+ALITM+I+ S + TL+EIY +I FP+F KN++ WQNSIRHNLSLN+CF+ Sbjct: 92 KPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFV 151 Query: 85 KVPRE-GGGERKGNYWTLDPQCGEMFENGNF 114 KVPR G KGNYWTL P CG+MF +G+F Sbjct: 152 KVPRSIFGKPGKGNYWTLHPSCGDMFGSGSF 182 >SB_47058| Best HMM Match : Fork_head (HMM E-Value=0) Length = 312 Score = 129 bits (312), Expect = 1e-30 Identities = 56/91 (61%), Positives = 71/91 (78%), Gaps = 1/91 (1%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KPP+SY+ALITM+I+ S + TL+EIY +I FP+F KN++ WQNSIRHNLSLN+CF+ Sbjct: 92 KPPFSYIALITMSIEASPYRMRTLNEIYEFIMTRFPYFRKNQQKWQNSIRHNLSLNDCFV 151 Query: 85 KVPRE-GGGERKGNYWTLDPQCGEMFENGNF 114 KVPR G KGNYWTL P CG+MF +G+F Sbjct: 152 KVPRSIFGKPGKGNYWTLHPSCGDMFGSGSF 182 >SB_34624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 128 bits (308), Expect = 3e-30 Identities = 56/105 (53%), Positives = 76/105 (72%) Query: 10 EIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGW 69 E+ + S Q+ KPPYSY+ALI MAI +S ++ TLSEIY +I++ FPF++ W Sbjct: 28 EVGDKKQSRRQQSRGKPPYSYIALICMAITSSPQRQLTLSEIYDFISQRFPFYQTCSIKW 87 Query: 70 QNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 +NSIRHNL+LN+CFIK+PRE KGNYWT+DP +MF+NG+F Sbjct: 88 KNSIRHNLTLNDCFIKLPREPNRPGKGNYWTIDPTSVDMFDNGSF 132 >SB_3400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 123 bits (297), Expect = 7e-29 Identities = 56/91 (61%), Positives = 69/91 (75%), Gaps = 1/91 (1%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFE-KNKKGWQNSIRHNLSLNECF 83 KPPYSYVALI+MAI+ S ++ TL+ IY +IT FP++ +NK+GWQNSIRHNLSLN CF Sbjct: 61 KPPYSYVALISMAIKQSPGRKITLNGIYHFITSAFPYYTWQNKRGWQNSIRHNLSLNRCF 120 Query: 84 IKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 +KV RE KG YWTLDP EMFE+G + Sbjct: 121 VKVHREKADPGKGCYWTLDPAYEEMFEDGKY 151 >SB_12905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 110 bits (264), Expect = 7e-25 Identities = 49/90 (54%), Positives = 61/90 (67%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 +PPYSY+ALI MA+QNS KR TL I +I FPF+ + W+ IR+NLSLN+CFI Sbjct: 109 RPPYSYIALIAMAVQNSPEKRLTLDGICKFIRDRFPFYRETYPSWKICIRNNLSLNDCFI 168 Query: 85 KVPREGGGERKGNYWTLDPQCGEMFENGNF 114 K + KGNYWTLDP+ MFENG+F Sbjct: 169 KTGIKSDEPLKGNYWTLDPESYNMFENGSF 198 >SB_5069| Best HMM Match : Fork_head (HMM E-Value=0) Length = 331 Score = 108 bits (260), Expect = 2e-24 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 2/106 (1%) Query: 9 SEIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKG 68 S + + T + A KP +SY+ALI MAI ++ +K+ L +IY YI+ FP++ K Sbjct: 66 SHLVKKETIVDDDADVKPAHSYIALIAMAILSNSSKKMILGDIYQYISDNFPYYRNKDKS 125 Query: 69 WQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 W+NSIRHNLSLNECFIK R G KGNYW + P E F NG+F Sbjct: 126 WRNSIRHNLSLNECFIKAGRSENG--KGNYWAIHPANLEDFANGDF 169 >SB_5331| Best HMM Match : Fork_head (HMM E-Value=0) Length = 503 Score = 108 bits (259), Expect = 3e-24 Identities = 51/103 (49%), Positives = 68/103 (66%), Gaps = 1/103 (0%) Query: 4 SSPGNSEIKAQTTSSNSQALT-KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFF 62 SS G+S +++S ++ KPPYSY LI AI ++ K+ TLS IYA+ITK +P++ Sbjct: 94 SSAGSSVSGDKSSSEGGKSEDGKPPYSYAQLIVQAILSATDKQLTLSGIYAHITKNYPYY 153 Query: 63 EKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC 105 KGWQNSIRHNLSLN F+KVPR KG++W +DP C Sbjct: 154 RTADKGWQNSIRHNLSLNRYFVKVPRAQDEPGKGSFWRIDPSC 196 >SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) Length = 460 Score = 108 bits (259), Expect = 3e-24 Identities = 52/102 (50%), Positives = 68/102 (66%), Gaps = 2/102 (1%) Query: 3 PSSPGN-SEIKAQTTSSNSQAL-TKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFP 60 P SP + S + +T + Q +KPPYSY LIT AI +S K+ TLSEIY +I FP Sbjct: 49 PGSPLDPSAVLDETEARQHQTKESKPPYSYANLITFAINSSPEKKMTLSEIYQWICDHFP 108 Query: 61 FFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLD 102 ++++ GW+NSIRHNLSLN+CFIKVPR KG+YW +D Sbjct: 109 YYKEAGNGWKNSIRHNLSLNKCFIKVPRSKDDPGKGSYWAID 150 >SB_53442| Best HMM Match : Fork_head (HMM E-Value=0) Length = 407 Score = 103 bits (246), Expect = 1e-22 Identities = 45/90 (50%), Positives = 61/90 (67%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KPPYSY LI MA+++++ + TLS IY +I + F F+ WQNSIRHNLSLN+CF+ Sbjct: 98 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFV 157 Query: 85 KVPREGGGERKGNYWTLDPQCGEMFENGNF 114 KVPR+ KG +W +DP +MF +G F Sbjct: 158 KVPRKKDEPGKGGFWRIDPAYADMFVDGVF 187 >SB_10139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 96.7 bits (230), Expect = 1e-20 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 2/90 (2%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KP SY+ LI AI + K+ LS+IY YI +P+F GW+NSIRHNLSLNECF+ Sbjct: 99 KPSQSYIGLIGKAIMSVPQKKLVLSDIYNYILTHYPYFRNKGAGWRNSIRHNLSLNECFV 158 Query: 85 KVPREGGGERKGNYWTLDPQCGEMFENGNF 114 KV R G KG++W ++P+ E F G + Sbjct: 159 KVGRSSNG--KGHFWAINPENYEDFSKGEY 186 >SB_10836| Best HMM Match : Fork_head (HMM E-Value=0) Length = 458 Score = 94.7 bits (225), Expect = 4e-20 Identities = 42/88 (47%), Positives = 60/88 (68%), Gaps = 1/88 (1%) Query: 17 SSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHN 76 S ++ +KPPYS+ +LI MAI+ S KR + +IY +I FP+F + GW+NS+RHN Sbjct: 114 SGKRKSPSKPPYSFSSLIFMAIEESPNKRLPVKDIYNWIMDHFPYFRDARLGWKNSVRHN 173 Query: 77 LSLNECFIKVPRE-GGGERKGNYWTLDP 103 LSLN+CF KV ++ G KG+ WT+DP Sbjct: 174 LSLNKCFKKVDKDKGQNVGKGSLWTVDP 201 >SB_15500| Best HMM Match : Fork_head (HMM E-Value=1.7e-39) Length = 554 Score = 94.3 bits (224), Expect = 5e-20 Identities = 47/104 (45%), Positives = 63/104 (60%), Gaps = 6/104 (5%) Query: 3 PSSPGNSEIKAQTTSSNSQALTK-----PPYSYVALITMAIQNSQTKRATLSEIYAYITK 57 P + + I + S SQ L K PP+SY+ALI AI NS KR TL+EI Y+ K Sbjct: 106 PCAVARNTIMMMSMSGGSQCLEKAERMKPPHSYIALIATAILNSPEKRLTLTEINEYLVK 165 Query: 58 EFPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGE-RKGNYWT 100 + FF + +GW+NS+RHNLS N+CF+K+ R+ K NYWT Sbjct: 166 HYVFFRGSYQGWKNSVRHNLSFNKCFVKILRDPARPWGKDNYWT 209 >SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 91.5 bits (217), Expect = 4e-19 Identities = 42/87 (48%), Positives = 58/87 (66%), Gaps = 3/87 (3%) Query: 29 SYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNK-KGWQNSIRHNLSLNECFIKVP 87 ++VA+I +I + TKR TLS IY++I K +P F+K K GW+NS+RHNLS N+CF+K Sbjct: 129 TFVAVIAQSILSVPTKRMTLSSIYSFIAKNYPHFDKEKGPGWRNSVRHNLSSNDCFVKAS 188 Query: 88 REGGGERKGNYWTLDPQCGEMFENGNF 114 R G KG+YW + P+ F GNF Sbjct: 189 RAENG--KGHYWMIHPKDLPEFSKGNF 213 >SB_665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 91.1 bits (216), Expect = 5e-19 Identities = 41/90 (45%), Positives = 58/90 (64%), Gaps = 2/90 (2%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECFI 84 KP SY++LI+ AI +S ++ LS+IY +I +P+F GW+NSIRHNLSLNECF+ Sbjct: 80 KPNQSYISLISEAILSSPEQKLILSDIYNFILTRYPYFRTKGTGWRNSIRHNLSLNECFV 139 Query: 85 KVPREGGGERKGNYWTLDPQCGEMFENGNF 114 K R G KG++W +D + F G+F Sbjct: 140 KAGRSPNG--KGHFWAIDATYFDDFRRGDF 167 >SB_17376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 87.0 bits (206), Expect = 8e-18 Identities = 47/107 (43%), Positives = 62/107 (57%), Gaps = 4/107 (3%) Query: 8 NSEIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKK 67 N+ K+Q + SQ KP SYVALI+ AI S KR TLSEIY I +FP+F + Sbjct: 4 NTIPKSQYRTGKSQR--KPSTSYVALISTAILESAEKRLTLSEIYDAIELKFPWFTATRM 61 Query: 68 GWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 GW+N++RHNLSL+ECF+K G K YW + + F G + Sbjct: 62 GWKNTVRHNLSLHECFVKGELSSNG--KSCYWRVHERFEGRFRRGEY 106 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 84.2 bits (199), Expect = 5e-17 Identities = 32/56 (57%), Positives = 40/56 (71%) Query: 59 FPFFEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQCGEMFENGNF 114 FPF+ N + WQNS+RHNLS N+CF+K+PR KG+ W L P CG MFENG+F Sbjct: 4 FPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENGSF 59 >SB_51547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 76.6 bits (180), Expect = 1e-14 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 3/69 (4%) Query: 47 TLSEIYAYITKEFPFFEKNK-KGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQC 105 TLS IY++I K +P F+K K GW+NS+RHNLS N+CF+K R G KG+YW + P+ Sbjct: 2 TLSCIYSFIAKTYPHFDKEKGPGWRNSVRHNLSSNDCFVKASRAENG--KGHYWMIHPKD 59 Query: 106 GEMFENGNF 114 F GNF Sbjct: 60 LPEFSKGNF 68 >SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) Length = 594 Score = 74.9 bits (176), Expect = 3e-14 Identities = 37/102 (36%), Positives = 62/102 (60%), Gaps = 6/102 (5%) Query: 4 SSPGNSEIKAQTTSSNSQ-ALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFF 62 S P + Q ++ Q A +PP++Y +LI AI +S + TL+EIY++ T+ F +F Sbjct: 386 SDPDGISLDIQRSADFYQKADVRPPFTYASLIRQAILDSPDTQLTLNEIYSWFTRTFAYF 445 Query: 63 EKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPQ 104 +N W+N++RHNLSL++CF++ +E KG W +D + Sbjct: 446 RRNAATWKNAVRHNLSLHKCFVR--KE---NVKGAVWMVDEE 482 >SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 72.5 bits (170), Expect = 2e-13 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 5/71 (7%) Query: 28 YSYVALITMAIQNSQTKRATLSEIYAYITKEFPFF-----EKNKKGWQNSIRHNLSLNEC 82 YSY LIT AIQ+S KR TLS+IY ++ P+F + GW+NSIRHNLSL+ Sbjct: 67 YSYADLITQAIQSSPEKRLTLSQIYDWMVNSVPYFRDKGDSNSSAGWKNSIRHNLSLHSK 126 Query: 83 FIKVPREGGGE 93 F++V EG G+ Sbjct: 127 FVRVQNEGNGK 137 >SB_647| Best HMM Match : Fork_head (HMM E-Value=3.5e-21) Length = 491 Score = 62.1 bits (144), Expect = 3e-10 Identities = 32/81 (39%), Positives = 47/81 (58%), Gaps = 15/81 (18%) Query: 24 TKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKGWQNSIRHNLSLNECF 83 T+PPYSY LI +AI +++ KR TL EIY +I + FP++ K KK W+ Sbjct: 59 TRPPYSYATLILLAINSTEEKRMTLQEIYKWIEERFPYYTKCKKAWKE------------ 106 Query: 84 IKVPREGGGERKGNYWTLDPQ 104 K P + G KG+YW++ P+ Sbjct: 107 -KRPADLPG--KGSYWSISPE 124 >SB_46386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 56.4 bits (130), Expect = 1e-08 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 7/78 (8%) Query: 29 SYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNK-----KGWQNSIRHNLSLNECF 83 SY LI AI S+ ++ TL +IY + P+F+ + KGW+N+IRH LSL + F Sbjct: 750 SYSDLIARAIDQSKFQKLTLPQIYDWFVINVPYFKAKEHLPSTKGWKNAIRHTLSLRQRF 809 Query: 84 IKVPREGGGERKGNYWTL 101 +++P G R ++WT+ Sbjct: 810 VRLPDPGNPYR--SWWTV 825 >SB_5489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 46.4 bits (105), Expect = 1e-05 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 4/87 (4%) Query: 24 TKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNK--KGWQNSIRHNLSLNE 81 +K SY L+ AI +S KR TL EIY + + W+N+IRH LS + Sbjct: 446 SKGTVSYSDLLAEAISSSPDKRLTLQEIYMWFEDNVAGISPSSVTHDWKNTIRHTLSRRK 505 Query: 82 CFIKVPREGGGERKGNYWTLDPQCGEM 108 F+++ ++ ++WT++P E+ Sbjct: 506 RFLRIAM--SEKKNKSWWTVNPAFSEI 530 >SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 45.6 bits (103), Expect = 2e-05 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 1/40 (2%) Query: 66 KKGWQNSIRHNLSLNECFIKVPR-EGGGERKGNYWTLDPQ 104 +K NS+RHNLSLN+ F K+ R +G +RKG W+L P+ Sbjct: 294 EKNLLNSVRHNLSLNKAFCKLERPQGASQRKGCLWSLKPE 333 Score = 36.3 bits (80), Expect = 0.014 Identities = 16/45 (35%), Positives = 25/45 (55%) Query: 11 IKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYI 55 I + N + KP +SY LI MA++NS + +SEIY ++ Sbjct: 156 ISKENAKPNEKCYPKPLFSYSCLIAMALKNSDSGTLPVSEIYKFM 200 >SB_40026| Best HMM Match : Fork_head (HMM E-Value=4.2e-05) Length = 156 Score = 44.8 bits (101), Expect = 4e-05 Identities = 24/54 (44%), Positives = 30/54 (55%) Query: 4 SSPGNSEIKAQTTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITK 57 S+ E K + + KP +SY ALI MAI+ S+ KR TLS IY YI K Sbjct: 40 SAEERKERKEKAGKDEQKNTEKPAFSYNALIMMAIRGSEEKRLTLSGIYEYIMK 93 >SB_51004| Best HMM Match : Fork_head (HMM E-Value=3) Length = 136 Score = 41.9 bits (94), Expect = 3e-04 Identities = 18/27 (66%), Positives = 21/27 (77%) Query: 25 KPPYSYVALITMAIQNSQTKRATLSEI 51 +PPYSY+ALI MA+QNS KR TL I Sbjct: 109 RPPYSYIALIAMAVQNSPEKRLTLDGI 135 >SB_38984| Best HMM Match : Fork_head (HMM E-Value=3e-06) Length = 246 Score = 37.9 bits (84), Expect = 0.005 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 18/89 (20%) Query: 15 TTSSNSQALTKPPY---SYVALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNK----- 66 TT + + K P+ SY LI AI S ++ TL +IY + + +F + Sbjct: 119 TTYDDQEKEKKKPWGNASYSDLIARAITQSTKQKLTLPQIYEWFVENVSYFRDREHLPST 178 Query: 67 KGW----------QNSIRHNLSLNECFIK 85 KGW QN+IRH LSL + F++ Sbjct: 179 KGWKLIRIPCAIIQNAIRHTLSLRQRFVR 207 >SB_58766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 71 NSIRHNLSLNECFIKVPREGGGERKGNYWTLDP 103 N++RH LS+ + F++V G + ++WT+ P Sbjct: 1 NTVRHTLSMRKRFVRVAMTSKGNK--SWWTVKP 31 >SB_28299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/48 (29%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Query: 87 PREGGGERKGNYWTLDPQCGEMFENGNFXXXXXXXXXXXANPYSKALF 134 P+EGGG+++G CG + + NPY KA F Sbjct: 126 PKEGGGDKEGG------SCGGSLYSRTYQTRYSRTSQKTGNPYKKAAF 167 >SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) Length = 169 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 30 YVALITMAIQNSQTKRATLSEIYAYITKEFPFFE 63 YV +I+ A++N K A+ I YI KEF E Sbjct: 13 YVDMISSAVKNLGGKGASRQAINKYIVKEFNLTE 46 >SB_19778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 27.1 bits (57), Expect = 8.7 Identities = 14/37 (37%), Positives = 21/37 (56%) Query: 32 ALITMAIQNSQTKRATLSEIYAYITKEFPFFEKNKKG 68 AL+ QN+QT ++ L E +A I + F KN+ G Sbjct: 129 ALVQSYEQNNQTIQSKLQEFFAVIERIGLFTRKNRTG 165 >SB_46521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 15 TTSSNSQALTKPPYSYVALITMAIQNSQTKRATLSEIYAYITKEFP 60 T S+ ++ LTKPPY L+ NS + + +AY T++ P Sbjct: 5 TFSAKNRHLTKPPYISRTLLPKH-DNSLLAQQENEDAFAYETRDLP 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.131 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,539,993 Number of Sequences: 59808 Number of extensions: 192941 Number of successful extensions: 419 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 373 Number of HSP's gapped (non-prelim): 37 length of query: 178 length of database: 16,821,457 effective HSP length: 78 effective length of query: 100 effective length of database: 12,156,433 effective search space: 1215643300 effective search space used: 1215643300 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -