BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000634-TA|BGIBMGA000634-PA|undefined (104 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 3.4 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 20 4.5 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 20.6 bits (41), Expect = 3.4 Identities = 8/33 (24%), Positives = 13/33 (39%) Query: 69 HPESFFDMNELPTNAYSLDTRRMQLYSHQHIHP 101 HP +D L Y ++ + + H HP Sbjct: 351 HPHKVYDFELLIKGVYQVNPTKTRTNLPTHRHP 383 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 20.2 bits (40), Expect = 4.5 Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Query: 68 LHPESF---FDMNELPTNAYSLDTRR 90 +H ES +N +PT Y+L+ +R Sbjct: 341 VHDESIKPLLTLNSVPTEIYNLEIQR 366 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.139 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,202 Number of Sequences: 317 Number of extensions: 1020 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 104 length of database: 114,650 effective HSP length: 49 effective length of query: 55 effective length of database: 99,117 effective search space: 5451435 effective search space used: 5451435 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.4 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -