BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000632-TA|BGIBMGA000632-PA|IPR001680|WD-40 repeat, IPR008042|Retrotransposon, Pao, IPR011046|WD40-like (451 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 24 2.5 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 4.4 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 7.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.8 bits (49), Expect = 2.5 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Query: 11 STPVPGPTAVGIESSDSRPTFK--PVTVLEDLQAVRCAEFHPNGKLYAVGSNTKTL 64 ++P P +V + P+ P TV ++ + + P G + GSNT +L Sbjct: 209 ASPAAAPRSVATPTGIPTPSTSASPPTVNIKKESPQMQSYRPTGNITPHGSNTSSL 264 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 23.0 bits (47), Expect = 4.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 16 GPTAVGIESSDSRPTFK 32 GP +VG+ S S P FK Sbjct: 202 GPNSVGVSSEVSLPQFK 218 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 7.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 108 KTEKDVLTFDLNLTRIPPPLVEGKTPTKREA 138 +TE DL++T PPPL K ++E+ Sbjct: 45 ETELSDSDCDLDVTGTPPPLDCSKNSPEKES 75 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,416 Number of Sequences: 317 Number of extensions: 4914 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 3 length of query: 451 length of database: 114,650 effective HSP length: 59 effective length of query: 392 effective length of database: 95,947 effective search space: 37611224 effective search space used: 37611224 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -