BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000632-TA|BGIBMGA000632-PA|IPR001680|WD-40 repeat, IPR008042|Retrotransposon, Pao, IPR011046|WD40-like (451 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.98 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 25 1.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 9.2 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.4 bits (53), Expect = 0.98 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 5/84 (5%) Query: 53 KLYAVGSNTKTLRICSYPKIEDVNLLETLGENENGNQVE--LYKPEEKTERVLGLIWKTE 110 K AVG + +R PK E +L + ++ + E + E +R+L + + Sbjct: 127 KCIAVGMSRDAVRFGRVPKREKARILAAMQQSSHSRSQEKAVAAELEDEQRLLATVVQAH 186 Query: 111 KDVLTFDLNLTRIPPPLVEGK-TP 133 D T D ++ P LV + TP Sbjct: 187 LD--TCDFTRDKVAPILVRARETP 208 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 25.0 bits (52), Expect = 1.3 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Query: 54 LYAVGSNTKTLRICSYPKIEDVNLLE 79 L+A+ LR+ S PKI+DVN+++ Sbjct: 441 LHAIRRGASILRV-SMPKIKDVNIID 465 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 9.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 185 RTKHHKGSIYCLAWSPAGDLLATGSNDKTVKLMAFNT 221 R + H CLA SPAG + + N + V ++T Sbjct: 71 RQEVHAQVYSCLARSPAGSVHSRDVNVRAVVAQYYDT 107 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,397 Number of Sequences: 429 Number of extensions: 6845 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 3 length of query: 451 length of database: 140,377 effective HSP length: 60 effective length of query: 391 effective length of database: 114,637 effective search space: 44823067 effective search space used: 44823067 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -