BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000630-TA|BGIBMGA000630-PA|IPR006595|CTLH, C-terminal to LisH motif (551 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 23 5.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 7.3 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 22 9.6 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 23.0 bits (47), Expect = 5.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Query: 470 QRECDDYIRNLCSSESRQPKSMEQVTDAPAGFSTAAKSQQQ 510 +R+ + +N + E +Q K E+VT + + +QQQ Sbjct: 197 ERQVKIWFQNRRAKERKQVKKREEVTQKDSPMNMGHLTQQQ 237 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 7.3 Identities = 11/35 (31%), Positives = 15/35 (42%) Query: 58 GQWDDVLEFIQPLSALKTFEANKFNYAILRHKYIE 92 GQWD + + P+ A FN H +IE Sbjct: 2019 GQWDKITGHVAPMYAHPEDADATFNTNFTIHYWIE 2053 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 22.2 bits (45), Expect = 9.6 Identities = 10/28 (35%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Query: 299 PFRRPRSAA-DAMTRSLRPLPDGAPRHP 325 P PR A + R +P G P+HP Sbjct: 112 PLPSPRRVAVPVLVRDGKPCLSGGPKHP 139 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.132 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,265 Number of Sequences: 317 Number of extensions: 4809 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 551 length of database: 114,650 effective HSP length: 60 effective length of query: 491 effective length of database: 95,630 effective search space: 46954330 effective search space used: 46954330 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -