BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000629-TA|BGIBMGA000629-PA|IPR011129|Cold shock protein, IPR002059|Cold-shock protein, DNA-binding, IPR008994|Nucleic acid-binding, OB-fold (776 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 26 1.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 25 1.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 25 1.5 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Query: 180 FSETKCKEELTLGDDVEFIIQTRNGKEVACNITKLPSGSV 219 + E KE L L V FI + V CN KLP ++ Sbjct: 64 YLERAIKESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTI 103 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 147 PVHPVKYHGVVCSMKENFGFIERAD 171 PVHPV+ + ++ E + F+ AD Sbjct: 376 PVHPVRVNTIISFSGERYDFVINAD 400 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 25.4 bits (53), Expect = 1.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 147 PVHPVKYHGVVCSMKENFGFIERAD 171 PVHPV+ + ++ E + F+ AD Sbjct: 376 PVHPVRVNTIISFSGERYDFVINAD 400 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,085 Number of Sequences: 317 Number of extensions: 7088 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 776 length of database: 114,650 effective HSP length: 62 effective length of query: 714 effective length of database: 94,996 effective search space: 67827144 effective search space used: 67827144 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -